KEGG   Drosophila mojavensis: Dmoj_GI16411Help
Entry
Dmoj_GI16411      CDS       T01062                                 

Definition
GI16411 gene product from transcript GI16411-RA
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dmo  Drosophila mojavensis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dmo00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dmo04310]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dmo04070]
Organismal Systems; Sensory system; Phototransduction - fly [PATH:dmo04745]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1094 aa AA seqDB search
MTKKYEFDWIIPVPPELTTGAVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGR
DGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIQELDKRSLTICSNTDYINITYHHV
ICPDAATAKSWQKNLRLITHNNRATNVCPRTNLMKHWMRLSYCVEKSGKIPVKTLAKTFA
SGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQ
DFISLEQFIQFMNEKQRDPRMNEILYPLYEEKRCTEIINDYENDEEKKKNGQLSLDGFKR
YLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGC
RCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNR
AQQYKLAKYCDDFFGDLLLKEPLPDHPLEPGLPLPPPCKLKRKILIKNKRMKPEVEKVEL
ELWLKGELKTDDDPEEDASAGKPPEAAAAPAPVPEAAAADAAAEGGGGAEAEAAAANYSG
STTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNK
RQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQTSDLPMQLNQGKFEYNGGCGYLLK
PDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKK
EFRTRLVPNNGLNPVYNEDPFVFRKVVLPDLAVLRFGVYEESGKMIGQRILPLDGLQAGY
RHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALG
IEEQSGGAARDAGKAKEEEKKEPPLVFEPVTLESLRQEKGFQKVGKKQIKELDTLRKKHA
KERTSVQKTQNAAIDKLIKGKSKDDIRNDATIKNAINDQTKQWTDMIARHRKEEWDMLRQ
HVQDSQDAMKALMLTVQAAQIKQLEDRHARDIKELNAKQAKTSADTAKEVQNDKTLKTKN
EKDRRLREKRQNNVKRFMEEKKQIGVKQGRAMEKLKLAHAKQVEEFSTDVQKLMDMYKIE
EEAYKTQGKTEFYA
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaagtacgagttcgattggataattccggtgccgccggaactaacaactggt
gcggtcttcgatcgctggttcgagaacgagaaggagaccaaagagaatgactttgagcgc
gatgcgctcttcaaagtcgatgagtatggtttctttctctactggaagagcgagggacgg
gatggcgatgtcattgagctgtgtcaagtgagcgacattcgagctggcggcactccaaag
gatccaaagatattggataaagtaaccaaaaagaatggcacgaatatacaggaactggat
aagcgttcgctcaccatatgctcgaacacggactatatcaatataacatatcatcatgtt
atttgccccgatgcagcaacagccaagagctggcaaaaaaacttgcgactcataacgcat
aacaatcgcgccaccaacgtgtgcccacgcaccaatctaatgaaacattggatgcgtctc
agctattgtgtggaaaagagtggcaagataccagttaagacgctggccaaaacattcgca
tctggcaaaactgagaagctggtgtacacgtgcatcaaggatgcgggcctgccggacgat
aagaatgcgacaatgacgaaggaacagttcacgtttgataagttttatgcgctctaccac
aaggtctgtccccgcaacgatatagaggagctattcacatcgatcacaaagggaaaacag
gattttatcagtctggaacagttcatacagttcatgaacgaaaagcagcgcgatccgcgc
atgaacgagatcctctatccgctttatgaggagaaacgctgcacggagattatcaatgac
tacgagaacgatgaggagaagaagaagaatggacaactctcgttggacgggttcaagcgc
tacctgatgtccgatgagaatgcgcccgtgtttctggatcgcctcgacttctatatggaa
atggaccagcccttggctcattactatatcaatagttcgcataatacgtatttgtccgga
cgtcagatcggcggcaagagctccgtcgaaatgtaccggcagactctgctcgcgggctgt
cgctgcgttgagctggattgctggaatggcaagggcgaggatgaggagccgattgttact
cacggccacgcctactgtacggaaatcttgtttaaggattgcattcaggccatagcggat
tgcgctttcgtctcgtcggaatatccggtgattctgtcctttgagaatcattgcaatcgg
gcgcagcaatacaaattagctaaatactgtgatgacttttttggtgatctgctactgaag
gagcctctgccggatcatccgctcgaaccgggtctaccgctgccgccgccgtgcaagcta
aagcgcaagattctcatcaaaaacaaacgcatgaagcccgaggtggagaaggtcgaactg
gagctctggctcaagggcgagctgaagaccgacgacgatcccgaggaggatgccagcgca
ggcaagccaccagaggccgctgctgccccggcgcccgttccagaggcagctgccgccgat
gccgcagccgagggcggaggcggtgccgaggcggaagcagctgctgccaactacagcggc
tccaccaccaatgtgcatccctggctctcatccatggtcaattatgcgcagcccatcaaa
ttccagggcttcgacaaggcaatcgaaaagaacatagcccacaacatgtcgtcgtttgcg
gaatcggcgggaatgaattacttgaagcagagctcgatcgactttgtcaattacaacaag
cgtcaaatgtcgcgcatctatccgaagggcacgcgagccgactcgtccaactatatgccg
caggtattttggaacgctggctgccagatggtctcattgaatttccagacatccgatctg
cccatgcaactgaatcagggcaaattcgagtacaatggcggctgcggctacttgctgaag
ccggactttatgcgacgcgccgacaaggacttcgatccgttcgcggatgctccggtggac
ggtgtgattgcggcccagtgctcggtgaaggtgatcgccggccagttcttgtcggacaag
aaggtgggcacctacgtggaggtggacatgtttggcctgccgtcggacactgtgaagaag
gaattccgcacgcgcctggtgcccaacaacgggctcaatcccgtctacaacgaggatccg
ttcgtgttccgcaaggtggtgctgcccgatttggcggtgctgcgctttggcgtctatgag
gagagcggcaaaatgattggacaacgcatcctgcccctggatggcctgcaggctggctac
cgccacgtctcgctgcgtaccgaggccaatttcccgatgtcgttgcccatgctgtttgtg
aacatcgaattgaagatttatgtacctgatggctttgaggacttcatggccatgctgtcg
gatccgcgcggctttgccggcgccgccaaacagcagaacgagcaaatgaaggcgctgggc
attgaggagcagagcggcggggccgctcgcgatgccggcaaggccaaggaggaggagaag
aaggagccgccgcttgtcttcgagccggtcaccctcgaatcgttgcggcaggagaagggc
tttcagaaggtcggcaagaagcagatcaaggagctggacacgctgcgcaagaagcacgcc
aaggagcgcacctcggtgcagaagacccaaaatgcggccatcgacaagttgatcaagggc
aagagcaaagatgatattcgcaacgatgcgaccattaagaatgcgatcaacgaccagacc
aagcagtggaccgacatgattgcacgccaccgcaaggaggaatgggacatgctgcgccag
catgtccaggactcccaggacgccatgaaggcgctcatgctgaccgtacaggcggcccag
atcaagcagctcgaggaccgtcatgccagggatatcaaagaactcaatgccaagcaggcc
aagacttcggctgacaccgccaaggaagtccaaaacgacaagacccttaagaccaaaaac
gaaaaggatcgtcgtctgcgcgaaaagcgtcagaacaatgtcaaacgctttatggaggag
aaaaagcaaatcggcgttaagcagggtcgcgccatggaaaaattgaaattggcacacgct
aaacaggttgaggaatttagtaccgatgtgcaaaagcttatggatatgtacaaaatcgag
gaggaggcctataagacccaaggaaagacggagttttatgcttaa

DBGET integrated database retrieval system