KEGG   Drosophila mojavensis: Dmoj_GI16556Help
Entry
Dmoj_GI16556      CDS       T01062                                 

Definition
GI16556 gene product from transcript GI16556-RA
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dmo  Drosophila mojavensis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:dmo00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 182 aa AA seqDB search
MVQVWYMDSDDSDQRLEHKREPVTYVDLETLYKKTGVEYFKINADDYENDEVLKELRRKR
GYTYEDQITCSEQCLPDYLNKLKAFYTEHLHTDEEIRLVIDGSGYFDVRDGEDNWLRIEV
IKGDLIIIPAGIYHRFTLDSKNYIKAQRYFVGEPVWAPHNRPADNMDCRKAYLEHLAKLS
KA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggtgtggtatatggacagtgatgatagcgatcagcgactagagcacaagcgc
gagccagtcacctatgtagatttggagacactctacaagaaaacaggcgtggagtacttt
aagatcaatgcggacgactatgagaacgacgaagtgctaaaagagctgcgcaggaagcgc
ggctatacttacgaggatcagatcacttgttccgaacaatgcctgcctgattacctaaac
aagctaaaggctttctacacggaacacttgcacacggatgaggagattcgattggttatt
gatggttccggctactttgatgtgcgcgatggcgaagacaactggttgcgcatagaggta
atcaagggcgatttgattataatacctgctggcatttatcaccgttttacactggacagc
aagaactatataaaagcgcaaagatactttgttggcgagccagtttgggctccacacaat
cggcccgctgataatatggattgccgtaaagcatatttagagcatttggcaaaattgagc
aaagcttaa

DBGET integrated database retrieval system