KEGG   Drosophila mojavensis: Dmoj_GI16556Help
Entry
Dmoj_GI16556      CDS       T01062                                 

Definition
GI16556 gene product from transcript GI16556-RA
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dmo  Drosophila mojavensis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dmoj_GI16556
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Dmoj_GI16556
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Dmoj_GI16556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 182 aa AA seqDB search
MVQVWYMDSDDSDQRLEHKREPVTYVDLETLYKKTGVEYFKINADDYENDEVLKELRRKR
GYTYEDQITCSEQCLPDYLNKLKAFYTEHLHTDEEIRLVIDGSGYFDVRDGEDNWLRIEV
IKGDLIIIPAGIYHRFTLDSKNYIKAQRYFVGEPVWAPHNRPADNMDCRKAYLEHLAKLS
KA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggtgtggtatatggacagtgatgatagcgatcagcgactagagcacaagcgc
gagccagtcacctatgtagatttggagacactctacaagaaaacaggcgtggagtacttt
aagatcaatgcggacgactatgagaacgacgaagtgctaaaagagctgcgcaggaagcgc
ggctatacttacgaggatcagatcacttgttccgaacaatgcctgcctgattacctaaac
aagctaaaggctttctacacggaacacttgcacacggatgaggagattcgattggttatt
gatggttccggctactttgatgtgcgcgatggcgaagacaactggttgcgcatagaggta
atcaagggcgatttgattataatacctgctggcatttatcaccgttttacactggacagc
aagaactatataaaagcgcaaagatactttgttggcgagccagtttgggctccacacaat
cggcccgctgataatatggattgccgtaaagcatatttagagcatttggcaaaattgagc
aaagcttaa

DBGET integrated database retrieval system