KEGG   Drosophila mojavensis: Dmoj_GI16558Help
Entry
Dmoj_GI16558      CDS       T01062                                 

Definition
GI16558 gene product from transcript GI16558-RA
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dmo  Drosophila mojavensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dmoj_GI16558
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dmoj_GI16558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 223 aa AA seqDB search
MISFLFIVNRAFSSASSTVMAQAATGPRPLVLCGPSGSGKSTLLKRLFAEFPDTFGFSVS
HTTRRPREGEEHGIHYYFVDRDVMEQAIANDEFIETAEFTGNMYGTSKEAVREIQNQGRV
CILDIEQKGVEQIKKTDLNPILIFNNPPTIDELERRLRKRNTETEETLAKRLNAAQVEIE
YGLTPGNFHKIIHNVDIDVAYEEFRNFVVEELKKQEAMGVRFN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttctgttcattgttaatcgtgcgttcagcagtgccagcagcacagtgatg
gcacaagcagctactgggccacgtccgctcgtgttgtgcggtccttcgggctcgggcaaa
agcacattgctgaaacgtttatttgccgaatttccggatacgtttggcttcagtgtgtcg
cacaccacacgccggccgcgcgaaggcgaggagcatggcatccactactatttcgtggac
cgggacgttatggagcaggccatcgccaatgatgagttcatcgaaacggcagaattcact
ggcaacatgtatggcacaagcaaggaggccgtccgtgagatccagaaccagggccgcgtc
tgcatattggacatcgaacagaagggcgtggaacagatcaagaaaaccgatctcaatccc
atcttgatcttcaacaatccaccgactatcgacgagcttgagcgacgtttgcgtaaacgc
aacaccgaaacggaggagacgctggccaagcggctcaatgcggcgcaggtggaaattgaa
tacggtctgacaccaggaaatttccacaagatcatacacaatgtggatatcgatgttgcc
tacgaggagttccgcaactttgtcgtcgaagagctgaagaagcaggaggcgatgggcgtg
cgcttcaattag

  All links  
No link information was found.   
DBGET integrated database retrieval system