KEGG   Drosophila mojavensis: Dmoj_GI16558Help
Entry
Dmoj_GI16558      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00230  Purine metabolism
dmo01100  Metabolic pathways
Module
dmo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dmoj_GI16558
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dmoj_GI16558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 AAA_16 ABC_tran RsgA_GTPase AAA_18 RNA_helicase MMR_HSR1 Mg_chelatase ATPase_2 AAA_29 AAA_28 AAA_5 AAA AAA_30 NACHT cobW AAA_21 T2SSE AAA_17 Pox_A32 AAA_24 AAA_14 Rad17 NTPase_1 Roc FtsK_SpoIIIE AAA_23
Motif
Other DBs
NCBI-GeneID: 6586601
NCBI-ProteinID: XP_002012212
FlyBase: FBgn0139306
UniProt: B4L9G8
Position
Unknown
AA seq 223 aa AA seqDB search
MISFLFIVNRAFSSASSTVMAQAATGPRPLVLCGPSGSGKSTLLKRLFAEFPDTFGFSVS
HTTRRPREGEEHGIHYYFVDRDVMEQAIANDEFIETAEFTGNMYGTSKEAVREIQNQGRV
CILDIEQKGVEQIKKTDLNPILIFNNPPTIDELERRLRKRNTETEETLAKRLNAAQVEIE
YGLTPGNFHKIIHNVDIDVAYEEFRNFVVEELKKQEAMGVRFN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttctgttcattgttaatcgtgcgttcagcagtgccagcagcacagtgatg
gcacaagcagctactgggccacgtccgctcgtgttgtgcggtccttcgggctcgggcaaa
agcacattgctgaaacgtttatttgccgaatttccggatacgtttggcttcagtgtgtcg
cacaccacacgccggccgcgcgaaggcgaggagcatggcatccactactatttcgtggac
cgggacgttatggagcaggccatcgccaatgatgagttcatcgaaacggcagaattcact
ggcaacatgtatggcacaagcaaggaggccgtccgtgagatccagaaccagggccgcgtc
tgcatattggacatcgaacagaagggcgtggaacagatcaagaaaaccgatctcaatccc
atcttgatcttcaacaatccaccgactatcgacgagcttgagcgacgtttgcgtaaacgc
aacaccgaaacggaggagacgctggccaagcggctcaatgcggcgcaggtggaaattgaa
tacggtctgacaccaggaaatttccacaagatcatacacaatgtggatatcgatgttgcc
tacgaggagttccgcaactttgtcgtcgaagagctgaagaagcaggaggcgatgggcgtg
cgcttcaattag

DBGET integrated database retrieval system