KEGG   Drosophila mojavensis: Dmoj_GI16605Help
Entry
Dmoj_GI16605      CDS       T01062                                 

Definition
(RefSeq) GI16605 gene product from transcript GI16605-RC
  KO
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dmo  Drosophila mojavensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dmoj_GI16605
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dmoj_GI16605
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dmoj_GI16605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 197 aa AA seqDB search
MAGRSLVSLMFGALAAAVGTYIYFTNQVDMSDGDYKNAASIYEFNVKDTHGNDVSLEKYK
GQVILIVNIASKCGLTKNNYKKLTDLKEKYGERGLTILNFPCNQFGSQMPEADGEAMVCH
LRDSKADIGEVFAKIDVNGDNAAPLYKYLKAKQSGTLGSGIKWNFTKFLVNREGVPINRY
APTTDPMDIAKDIEKLL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcgttcgctggtatcccttatgtttggtgcactggctgctgccgtgggcacc
tacatctacttcacgaatcaagtcgacatgtcggacggtgattacaagaacgcagcctcg
atctacgagttcaacgtgaaggacacccatggaaacgatgtctccctggaaaagtataag
ggccaggttatccttatcgtcaatattgcttcaaagtgtggtttaactaaaaataactac
aagaagttgaccgatctgaaggagaagtatggcgaacgcggactgaccatcctgaacttc
ccatgcaatcaatttggctcccaaatgccagaggccgatggggaggccatggtctgtcat
cttcgtgactctaaagcagacattggcgaagtctttgccaagattgatgtgaatggcgat
aatgcagcgcctttgtataagtacttgaaggccaagcaatctggcaccttgggcagcggc
atcaaatggaacttcaccaaattcctggtgaacagggagggcgttccaatcaatcgatat
gcacccactaccgatcccatggacattgccaaggatatcgagaaactattgtag

DBGET integrated database retrieval system