KEGG   Drosophila mojavensis: Dmoj_GI16638Help
Entry
Dmoj_GI16638      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dmoj_GI16638
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmoj_GI16638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys SLT Transglycosylas
Motif
Other DBs
NCBI-GeneID: 6586450
NCBI-ProteinID: XP_002012064
FlyBase: FBgn0139386
UniProt: B4L920
Position
Unknown
AA seq 140 aa AA seqDB search
MKAFIVLLALAFAAPAFGRTMDRCSLAREMADLGVPRDQLNKWTCIAEHESSYRTGVVGP
ENYNGSNDYGIFQINDYYWCQPASGRFSYNECALSCNALLTDDITNSVRCAQKIQRQQGW
TAWSTWKYCDGALPSINDCF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcatcgttctgctcgctctggctttcgccgcccccgctttcggtcgcacc
atggaccgttgctccctggcccgcgagatggccgacttgggcgttccccgtgaccagctg
aacaagtggacctgcattgccgagcacgagagctcctaccgcaccggcgttgttggcccc
gagaactacaacggctccaacgactacggcatcttccagatcaacgactactactggtgc
cagcctgccagcggtcgcttctcctacaacgagtgcgccctcagctgcaacgccctgttg
accgatgacatcaccaactccgtccgttgcgcccagaagatccagcgccagcagggctgg
actgcctggtccacctggaagtactgcgatggtgctctcccctccatcaacgactgcttc
taa

DBGET integrated database retrieval system