KEGG   Drosophila mojavensis: Dmoj_GI16643Help
Entry
Dmoj_GI16643      CDS       T01062                                 

Definition
GI16643 gene product from transcript GI16643-RA
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dmoj_GI16643
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmoj_GI16643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 140 aa AA seqDB search
MKAFIVLVALALAAPAFGRTLNRCSLAQEMSNLGVPRDQLARWACIAEHESSYRTGVVGP
ENYNGSNDYGIFQINNYYWCQPANGRFSYNECALSCNALLTDDITNSVRCAQKILSQQGW
TAWSTWKYCDGALPSINDCF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcattgttttagttgctctggctttggccgcccccgctttcggtcgcacc
ctgaaccgttgctccctggctcaggagatgtccaacttgggcgttccccgtgaccagctg
gcccgttgggcttgcattgccgagcacgagagctcctaccgcaccggcgttgttggcccc
gagaactacaacggctccaacgactacggcatcttccagatcaacaactactactggtgc
cagcctgccaacggtcgcttctcctacaacgagtgcgccctcagctgcaacgccctgttg
accgatgacatcaccaactccgtccgttgcgcccagaagatcctcagccagcagggctgg
accgcatggtccacctggaagtactgcgacggtgctctcccctccatcaacgactgcttc
taa

DBGET integrated database retrieval system