KEGG   Drosophila mojavensis: Dmoj_GI17059Help
Entry
Dmoj_GI17059      CDS       T01062                                 

Definition
GI17059 gene product from transcript GI17059-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dmo  Drosophila mojavensis
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmoj_GI17059
   00053 Ascorbate and aldarate metabolism
    Dmoj_GI17059
   00500 Starch and sucrose metabolism
    Dmoj_GI17059
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmoj_GI17059
   00860 Porphyrin and chlorophyll metabolism
    Dmoj_GI17059
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmoj_GI17059
   00982 Drug metabolism - cytochrome P450
    Dmoj_GI17059
   00983 Drug metabolism - other enzymes
    Dmoj_GI17059
Enzymes [BR:dmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmoj_GI17059
Glycosyltransferases [BR:dmo01003]
 Others
  Hydrophobic molecule
   Dmoj_GI17059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 542 aa AA seqDB search
MGRSLLSGTFVCLLLGFFVLQSARVEGANILGVFTSHSPSHFIINMSIMKALAEDGHNVT
VVSGTPPKVTHKSIKHIVIPLSAAEEKELNDGMSSLAKEKPSVFTTFRNIFGSLSMLIYK
QVDVLEDTRFTDLYKNKDNKFDAVIVGFFFNNYQVGLGSLFNCPIILTWTGPPMMQIDRN
IGNPELISSVPSMHVAVAPGRAMNFKERLANFGGTMFFRLFAFYLEILNDKFYDRLWGNI
PSMMTYEQAKQNISLAFCSSHGISEGPIRPNVPALVEIGGIQIKDKRDPLPEDIQQFLDG
AKHGAILFSLGSNLKGDHIDPQIIKKIFKVLAGLKQRVIWKWDDLDKLPGKSANILFKKW
MPQDDILAHPNIKLFITHAGKGGVTESQYHGKPMLALPVFADQPGNADKLVESGYGLKLD
LLTLEVDEFKDAIKELLSNPTYTNKIQHFSKIYRDRPMSARDSVIYWVNYVLRHHGAAHM
QSPLVKMGYIATHNIDLYLLLAAILLVIVLISKAVLRFVWSKCCGGRATKQKSSQKTKVK
KH
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgatcactgctgtccggcacatttgtgtgcctcctgcttggattctttgtgctg
cagtcggccagagtcgagggcgccaacatattgggcgtcttcaccagccacagtccatca
catttcataatcaacatgtcgattatgaaggccctggcggaggatggacacaatgtgacc
gtggtatcgggcactcctccaaaagtgacccacaagagcatcaagcacatcgttatcccg
ctgagtgcagccgaggagaaggagttgaacgacggcatgagctccttggccaaagagaag
ccgtcggtatttacaacgttcaggaatatattcggttcgctgtctatgctcatctataag
caagtagatgtcctggaggacacacgattcaccgatctctacaagaacaaagacaataaa
ttcgatgcagttattgttggtttcttcttcaacaactatcaggtgggactgggtagcctc
ttcaattgtcccattattctgacttggactgggccgccgatgatgcaaatcgacagaaat
atcggtaatcccgaattgatttcgtcagtgccctccatgcatgtagccgtggctccaggc
cgagcgatgaactttaaggagcgtctggccaatttcggtggcaccatgttcttccgtctt
tttgccttctacttggagatactgaatgacaagttttatgatcgtctatggggtaacatt
ccgtccatgatgacctatgagcaggccaagcagaacatttccctggctttttgcagcagt
cacggcataagcgagggacccattagacccaatgtgccggcgcttgtggagattggtggc
atacagattaaggataagcgagatccgctgcccgaggatattcagcagtttttagatggg
gccaagcatggcgcgattctcttcagtctgggcagtaatctgaaaggcgatcacattgat
ccacagataatcaaaaagatattcaaagtgctcgctgggctgaagcagcgtgtgatctgg
aagtgggatgatctggacaagttgcctggcaaatcggcaaatatactcttcaagaagtgg
atgccacaggacgacattcttgcccaccccaacattaagcttttcatcacgcatgcaggc
aaaggaggcgtcaccgagtcccagtaccatggcaagcccatgctagctcttccagtgttc
gccgatcagccaggaaatgctgataaactggtggaatcgggttatggcttgaagctcgat
ttgctgaccctagaggtggacgaattcaaggatgcaatcaaggagctgctgagcaatccc
acctacaccaataagattcaacatttctcaaagatctaccgcgatcgtccaatgtcggct
cgcgattcggttatctactgggttaactatgtccttcgtcatcacggagccgcccatatg
cagagtcccctagtcaaaatgggctacattgctacccacaatattgacttgtatctacta
ctggcagcgatactcttggttatcgttctgataagcaaagctgtgctgaggttcgtatgg
agcaagtgttgtggcggcagagccacgaagcaaaagtcttcacaaaaaacaaaggtcaag
aagcactag

DBGET integrated database retrieval system