KEGG   Drosophila mojavensis: Dmoj_GI17156Help
Entry
Dmoj_GI17156      CDS       T01062                                 

Definition
GI17156 gene product from transcript GI17156-RA
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Dmoj_GI17156
    1.3.1.94  polyprenol reductase
     Dmoj_GI17156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 323 aa AA seqDB search
MVLTLIGSLEELIDQYKINLIQAIFIIFIVTIVLLGSLMTLVESHLPNSIRQSFRYGKHS
HKGETDTLVNYLEVPKAWFSHFYVFAFGWSLLALYLITSAIWNQATAPEYVLRFMDFMCG
GRSQRQVQVDSNTALIGTLLLSLQCVRRFYETNFVQIFSKRSKMNLSHYAVGFIHYFGAI
VALLANTAGFVRGSKPSPFTLSKISLLQTAYVLVFLFAWLQQYSSNMLLVNLRKNAKTGA
VQTEEHLMPKGGWFNWISSPHMFFEVVMYYCLADLFTPIITWKLIFIWVASNQTINALLT
HQWYKENFKDYPKRRHAIIPLLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgacattaattggctccctggaggagctaatagatcagtacaaaatcaatcta
attcaagcgattttcatcatttttattgtcacgatcgttttgctgggcagtttgatgacc
cttgtggaatcccacctaccaaatagcatacgtcaatcatttcgctatggcaaacatagt
cacaagggcgaaacggatactctggtgaattacttggaagttcccaaggcctggtttagc
cacttttatgtatttgccttcggctggtcgttattggcgctctacctaatcaccagcgcc
atttggaatcaagcaacagcgccggagtatgtgcttcgctttatggacttcatgtgtggt
ggtcgtagtcagcgccaggtgcaggtggactccaacaccgctctgataggcactttgctg
cttagtttgcaatgcgtgcgtcgcttctacgagacgaattttgtgcagatcttctccaag
cgcagcaagatgaatctgtcgcactatgccgtgggttttatacactatttcggagccatt
gtcgctctgctggccaacacggctggctttgtgagggggtcaaagccatcaccctttacg
ctctctaagatcagtctgctccaaacagcctatgtgctcgtcttcctcttcgcatggctt
caacaatattcaagcaatatgttgcttgtgaatctgcgcaagaatgccaagacgggcgcc
gtgcaaaccgaggagcacttgatgcccaaaggcggttggttcaattggatatcttctccc
cacatgttcttcgaagtggtcatgtactattgtctcgcggatctttttacaccaatcatc
acttggaaactgatcttcatctgggtggccagcaatcagacgatcaatgccctgctcacc
catcaatggtacaaagagaacttcaaggactaccccaagaggcgacatgccatcatacca
ctgttgctgtaa

DBGET integrated database retrieval system