KEGG   Drosophila mojavensis: Dmoj_GI17241Help
Entry
Dmoj_GI17241      CDS       T01062                                 

Definition
GI17241 gene product from transcript GI17241-RA
Orthology
K01205  
alpha-N-acetylglucosaminidase [EC:3.2.1.50]
Organism
dmo  Drosophila mojavensis
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Lysosome
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dmo00531]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dmo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 773 aa AA seqDB search
MVGRIKLCALLTFVYFLTLTKCDLGTDLAARIAPDTSPDVQEDAAKQLIQRVIGLRASQW
FQVEVNRILDPSSYQISRLDNGKVLITGSNGVSVCKGFHYYLKFVLKKDFDWFKTHIELP
EDWDPPNVTHRSKSSSPLIYYQNPCVWSYSFVWWQFDEWRRHIDWMAMMGINLVIAPNQE
TIWQDVYTELGLTPQEIEAHFAGPAFQAWQRMGNLRSWGGPLPPAHRQLQQLLQQRILAA
QRELGMSVALPAFSGYVPTAMRRVFPNASFTQSDRWNHFPDPYCCVLFVEPQDPLFQQVG
AMFLRRVIQVYGSNHIYFSDPFNEMMPRVREPNYVRYTAKAIYNSMQVVDADAVWLIQGW
MFLKSVYWTNDLIEAYLTAVPRGRILALDLQSEQFPQYERTHSYYGQPFVWCMLNNFGGN
LGLFGSAQLIPSGIIAARSMPNGSMVGVGITPEGIGQNYALFALTLEQAWSPDELQLEDW
FEYFALTRYGVNDTRLSQVWQLLRESVYSFQGRERMRGKYTLNKRPSLHHYPWVWYNVTM
VYEAWRLMLEAKETVPLNDNRRAIYEHDLVDITRQCLQLSFDRFYVNLKSACRHKQLNRV
EYLAGKLLELFADMERILASGEHYLLGNWLEAAKRLAPSEEQRPIYEFNARNQLTSWGPN
YQIPDYATKQWSGLMSDYFQPRWNMFLEAVIQALKTQTPFNYSEFKQRVENEIELPFSNH
TKAYPTSPVGSTWNISHDIYEKWNAYSRDTLFLNYCQIAVTVAQTQKSGEEEW
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggtcgggcgcatcaaattgtgtgcactcttgacatttgtctattttttgaccttgaca
aaatgcgatctcggaacggatttggcagcacgtattgcaccagacacatcgcccgatgta
caggaagatgctgcgaaacagcttattcagcgtgttattggacttcgagcatcgcaatgg
tttcaggtggaagttaacaggattctggacccgagtagctatcagataagtcgcttagat
aatggaaaggtgttgattactggatcaaatggagtctctgtatgcaagggcttccattat
tatctaaagtttgtgctgaaaaaggatttcgattggtttaaaacgcatattgagctgccg
gaagactgggatccgcctaatgtaacacaccgctcaaaatccagcagtccgcttatctat
tatcaaaatccttgcgtttggagctatagctttgtatggtggcaatttgatgagtggcgg
cgtcacatcgattggatggccatgatgggcattaatctagtgatcgcccccaatcaggag
accatctggcaggatgtctatacagagctgggactaacgccacaggaaatcgaggcacac
tttgcgggtcctgcattccaagcctggcaacgcatgggcaatttgcgaagctggggtgga
cctttgccgcctgcacacaggcagctgcagcaactactgcaacagcggatactagcggca
cagcgtgagctgggcatgagcgtggctctgcctgcgtttagtggatatgtgccgaccgca
atgcggcgcgtctttcccaatgccagcttcacgcagtccgaccgatggaaccattttcct
gatccctattgctgtgtcctgtttgttgagccgcaagatccgctctttcagcaggtgggc
gcaatgtttttgcgccgggtcatccaagtctatggctccaatcacatctacttcagtgat
ccgttcaacgagatgatgccacgtgttcgcgagccgaactacgtgcgatacacagccaag
gccatttacaactcgatgcaagtggtggatgctgatgctgtgtggctgatacagggttgg
atgttcttgaagtccgtctactggacaaatgacctcatcgaggcgtacctcaccgctgtg
ccacggggtcgcatcctggcgttggacctacaaagcgaacaatttccgcaatacgagcgg
acgcactcctactatggccagccctttgtgtggtgcatgctgaacaatttcggtggcaac
cttggcctctttggctccgcccagctgatccctagtggaatcatagctgcacgctccatg
cccaacggcagtatggtgggcgtgggtataacgcccgaaggcatcggccaaaactatgcc
ttgttcgcccttactctcgagcaagcctggagtccagatgagctgcagcttgaagattgg
ttcgagtactttgctttgacacgttacggcgtaaatgatacgcgcttatcgcaggtgtgg
caacttctgcgggagagcgtttactcctttcaaggccgagagcgcatgcgtggaaagtat
acgttgaacaaaaggccgagcttacatcattatccttgggtttggtacaatgtaaccatg
gtctatgaggcttggcgcctaatgctggaagcgaaggaaacggtacctctaaatgataac
aggcgtgccatctatgagcacgacttggtggatatcacgcgccagtgtctccagctgagc
ttcgatcgcttttacgtcaatctcaagtcagcttgtcgccataagcaactcaatcgtgtg
gaatatctggctggcaaactgttggaactgtttgcagatatggagcgaatactagccagt
ggagagcattatttactgggcaactggctggaggccgccaagcgattggcgcccagtgag
gaacagcgtccaatctacgaatttaatgcacgaaatcaactgacgtcctggggaccaaat
tatcagattcctgactatgcgacgaaacaatggtctggcctgatgagcgattatttccag
ccccgttggaatatgtttctggaggctgtaatacaggcgctgaaaacacagacgcctttc
aattactccgaattcaaacagcgggttgagaacgaaattgagttgccatttagcaaccac
accaaggcatatcccacatctccagtagggagcacgtggaatatctcacacgatatctat
gagaaatggaatgcttattcgagagatacgctctttctgaattattgccaaattgctgta
acggtagcgcaaacccaaaaatcaggagaagaggagtggtaa

DBGET integrated database retrieval system