KEGG   Drosophila mojavensis: Dmoj_GI17241Help
Entry
Dmoj_GI17241      CDS       T01062                                 

Definition
GI17241 gene product from transcript GI17241-RA
Orthology
K01205  
alpha-N-acetylglucosaminidase [EC:3.2.1.50]
Organism
dmo  Drosophila mojavensis
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dmoj_GI17241
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dmoj_GI17241
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.50  alpha-N-acetylglucosaminidase
     Dmoj_GI17241
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmoj_GI17241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 773 aa AA seqDB search
MVGRIKLCALLTFVYFLTLTKCDLGTDLAARIAPDTSPDVQEDAAKQLIQRVIGLRASQW
FQVEVNRILDPSSYQISRLDNGKVLITGSNGVSVCKGFHYYLKFVLKKDFDWFKTHIELP
EDWDPPNVTHRSKSSSPLIYYQNPCVWSYSFVWWQFDEWRRHIDWMAMMGINLVIAPNQE
TIWQDVYTELGLTPQEIEAHFAGPAFQAWQRMGNLRSWGGPLPPAHRQLQQLLQQRILAA
QRELGMSVALPAFSGYVPTAMRRVFPNASFTQSDRWNHFPDPYCCVLFVEPQDPLFQQVG
AMFLRRVIQVYGSNHIYFSDPFNEMMPRVREPNYVRYTAKAIYNSMQVVDADAVWLIQGW
MFLKSVYWTNDLIEAYLTAVPRGRILALDLQSEQFPQYERTHSYYGQPFVWCMLNNFGGN
LGLFGSAQLIPSGIIAARSMPNGSMVGVGITPEGIGQNYALFALTLEQAWSPDELQLEDW
FEYFALTRYGVNDTRLSQVWQLLRESVYSFQGRERMRGKYTLNKRPSLHHYPWVWYNVTM
VYEAWRLMLEAKETVPLNDNRRAIYEHDLVDITRQCLQLSFDRFYVNLKSACRHKQLNRV
EYLAGKLLELFADMERILASGEHYLLGNWLEAAKRLAPSEEQRPIYEFNARNQLTSWGPN
YQIPDYATKQWSGLMSDYFQPRWNMFLEAVIQALKTQTPFNYSEFKQRVENEIELPFSNH
TKAYPTSPVGSTWNISHDIYEKWNAYSRDTLFLNYCQIAVTVAQTQKSGEEEW
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggtcgggcgcatcaaattgtgtgcactcttgacatttgtctattttttgaccttgaca
aaatgcgatctcggaacggatttggcagcacgtattgcaccagacacatcgcccgatgta
caggaagatgctgcgaaacagcttattcagcgtgttattggacttcgagcatcgcaatgg
tttcaggtggaagttaacaggattctggacccgagtagctatcagataagtcgcttagat
aatggaaaggtgttgattactggatcaaatggagtctctgtatgcaagggcttccattat
tatctaaagtttgtgctgaaaaaggatttcgattggtttaaaacgcatattgagctgccg
gaagactgggatccgcctaatgtaacacaccgctcaaaatccagcagtccgcttatctat
tatcaaaatccttgcgtttggagctatagctttgtatggtggcaatttgatgagtggcgg
cgtcacatcgattggatggccatgatgggcattaatctagtgatcgcccccaatcaggag
accatctggcaggatgtctatacagagctgggactaacgccacaggaaatcgaggcacac
tttgcgggtcctgcattccaagcctggcaacgcatgggcaatttgcgaagctggggtgga
cctttgccgcctgcacacaggcagctgcagcaactactgcaacagcggatactagcggca
cagcgtgagctgggcatgagcgtggctctgcctgcgtttagtggatatgtgccgaccgca
atgcggcgcgtctttcccaatgccagcttcacgcagtccgaccgatggaaccattttcct
gatccctattgctgtgtcctgtttgttgagccgcaagatccgctctttcagcaggtgggc
gcaatgtttttgcgccgggtcatccaagtctatggctccaatcacatctacttcagtgat
ccgttcaacgagatgatgccacgtgttcgcgagccgaactacgtgcgatacacagccaag
gccatttacaactcgatgcaagtggtggatgctgatgctgtgtggctgatacagggttgg
atgttcttgaagtccgtctactggacaaatgacctcatcgaggcgtacctcaccgctgtg
ccacggggtcgcatcctggcgttggacctacaaagcgaacaatttccgcaatacgagcgg
acgcactcctactatggccagccctttgtgtggtgcatgctgaacaatttcggtggcaac
cttggcctctttggctccgcccagctgatccctagtggaatcatagctgcacgctccatg
cccaacggcagtatggtgggcgtgggtataacgcccgaaggcatcggccaaaactatgcc
ttgttcgcccttactctcgagcaagcctggagtccagatgagctgcagcttgaagattgg
ttcgagtactttgctttgacacgttacggcgtaaatgatacgcgcttatcgcaggtgtgg
caacttctgcgggagagcgtttactcctttcaaggccgagagcgcatgcgtggaaagtat
acgttgaacaaaaggccgagcttacatcattatccttgggtttggtacaatgtaaccatg
gtctatgaggcttggcgcctaatgctggaagcgaaggaaacggtacctctaaatgataac
aggcgtgccatctatgagcacgacttggtggatatcacgcgccagtgtctccagctgagc
ttcgatcgcttttacgtcaatctcaagtcagcttgtcgccataagcaactcaatcgtgtg
gaatatctggctggcaaactgttggaactgtttgcagatatggagcgaatactagccagt
ggagagcattatttactgggcaactggctggaggccgccaagcgattggcgcccagtgag
gaacagcgtccaatctacgaatttaatgcacgaaatcaactgacgtcctggggaccaaat
tatcagattcctgactatgcgacgaaacaatggtctggcctgatgagcgattatttccag
ccccgttggaatatgtttctggaggctgtaatacaggcgctgaaaacacagacgcctttc
aattactccgaattcaaacagcgggttgagaacgaaattgagttgccatttagcaaccac
accaaggcatatcccacatctccagtagggagcacgtggaatatctcacacgatatctat
gagaaatggaatgcttattcgagagatacgctctttctgaattattgccaaattgctgta
acggtagcgcaaacccaaaaatcaggagaagaggagtggtaa

DBGET integrated database retrieval system