KEGG   Drosophila mojavensis: Dmoj_GI17571Help
Entry
Dmoj_GI17571      CDS       T01062                                 

Definition
(RefSeq) GI17571 gene product from transcript GI17571-RA (EC:2.7.11.-)
Organism
dmo  Drosophila mojavensis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 353 aa AA seqDB search
MGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRV
MIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWF
ASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaacgcgaccacatccaacaagaaggtggatgccgccgagacggtgaaggag
tttctcgaacaggccaaggaggagttcgaggataaatggcgtcgcaatccaaccaatacg
gcggcgctcgatgatttcgagcggatcaagacactgggcaccggctcctttggccgtgtg
atgatcgtccagcacaagccaacaaaagactattatgccatgaagatattggacaagcag
aaggtggtcaagctgaagcaggtggagcatacgctcaatgagaagcgcatcctgcaggcg
atacagttcccattcttggtctcgctccgctatcatttcaaggacaactccaatctctat
atggtgctggagtatgtgcccggcggcgagatgttctcgcatctgcgcaaagtcggaaga
ttctcggagccccactctcgtttctatgcggcacagattgtgctcgcctttgagtatttg
cattatctggacctcatctatcgcgatctgaagccggagaatttgctgattgattcgcag
ggttatttgaaggtcaccgatttcggttttgccaaacgtgtcaagggtcgcacctggacg
ctgtgcggcacacccgaatatctggcacccgaaataatcttgtccaagggctacaacaag
gccgtcgattggtgggcgttgggcgtgctggtctatgaaatggccgccggctatccgccg
ttctttgcggaccaacccatacagatctacgagaagatcgtctccggcaaggtgcgtttc
ccctcgcacttcggctccgatctgaaggatctgttgcgcaacttgttgcaagtggatctg
accaaacgctatggcaatctgaaagcgggcgtcaatgatattaagaatcagaaatggttc
gcctccacggactggatagcgatcttccaaaagaaaatcgaggcgccgttcataccgcgg
tgtaaagggcccggagacacaagcaatttcgatgattacgaggaggaggcgttgcgaatt
tccagcaccgagaagtgcgccaaggagtttgccgaattctag

DBGET integrated database retrieval system