KEGG   Drosophila mojavensis: Dmoj_GI17575Help
Entry
Dmoj_GI17575      CDS       T01062                                 

Definition
GI17575 gene product from transcript GI17575-RA
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
dmo  Drosophila mojavensis
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:dmo01200]
Metabolism; Overview; Fatty acid metabolism [PATH:dmo01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dmo00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dmo00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dmo00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:dmo00071]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dmo01040]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:dmo00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dmo00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:dmo00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:dmo00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 791 aa AA seqDB search
MSSRILCAIGQIARQQLLHHKCSRVYPASVQLHRRLMSTNPAPKIAPAAAPAATASNKHL
HTKVVNGVLVIRFDSPDAKVNSLGSEVSDEFERVIKELETNPSVNSAVLISGKPGCFIAG
ADIGMLEACQTAEEATLISHGAQLMFERLERSRKPVVAAISGVCLGGGLELALACHYRIA
TKDNKTKLGLPEVMLGLLPGGGGTVRLPKLTSVPTALDLELTGKQVRADRAKRLGIVDLL
VDPIGPGLQPAEQNTMDYLEKTAIQVANDLASGKLRVNREKSGLVNKLQALVMDTDFVKN
KIFDTARKQVMKASGGLYPAPLKILDVIRTGVDKGTDAGYEAERKGFGELSATPESKGLI
ALFRGQTECKKNRFGKPQRAVKTVGVLGAGLMGAGIVQVSVDKGYNVVMKDATDAGLARG
IGQVQKGLETAVKRKRITALERDQTLAHLLPTLNYNDFKTADIVIEAVFEDIKIKHRVIK
ELEAVVPEHCVIATNTSAIPITKIAAGSSRPDKVVGMHYFSPVDKMQLLEIITHPGTSKD
TVAQAVAVGLKQGKVVITVGDGPGFYTTRILATMLSEAIRLLQEGVDAKELDQLTKKFGF
PVGAATLADEVGIDVGSHIAVDLAKSFGERFSGGNLEVMQDLVLAGFLGRKSGKGIFLYD
GQSKGSRPVNTEALEIVKQKYSLVSKGANTPEDLTLRMVSRFVNEAVLCLEEKILDSPLE
GDVGAVFGLGFPPFTGGPFRWVDQYGAGKLASKMQSYAELYGAPFKPAQTLIDMAKDPSK
KFYPKTNAAKL
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcccgaattctgtgtgcaattggtcaaatagcccgacaacaattgctgcaccat
aaatgctccagagtgtacccggcatcagtgcagttacatcgtcgcctaatgtccacaaat
ccagccccgaagatcgcgccggctgccgcccccgctgctaccgcctccaataagcatctg
cacacgaaggtcgtgaatggagtgctcgttattaggttcgactcgcccgatgccaaggtc
aactctctgggcagcgaggtgagcgatgagtttgagcgtgtgattaaagagctggagacg
aatccctcggtcaactcggctgtgctcatctcgggcaagccgggctgctttatagccggc
gccgatatcggcatgctggaggcgtgccagacggccgaggaggcaactctcatctcgcac
ggcgcccagctgatgtttgagcgcctggagcgcagtcgcaagcccgttgtggccgccatc
agcggcgtctgcctaggcggaggactggagctggcgcttgcctgccactatcgcattgca
accaaggataacaagacgaaactgggtctgccggaggtcatgttgggtctgctgcccggc
ggcggcggcactgtgcgcctgcccaagctaacatccgtgcccacggcactggatctggag
ctgacgggcaaacaggtgcgtgccgatcgcgccaaacgcttgggcattgttgacttgctc
gtcgatcccattggccccggactgcagcccgccgaacagaataccatggattacctggaa
aagacggccattcaagtggccaacgacttggccagcggcaaactgcgcgtcaatcgcgag
aaatctggcttggtcaacaagctgcaagcactcgtcatggacacagattttgtgaagaac
aaaatctttgataccgcgcgcaagcaggtgatgaaggcttctggaggactctatcctgct
cccctgaaaattctggatgtgattcgcactggcgtcgataagggcaccgatgctggctac
gaggcggagcgcaagggctttggcgaactctcggccacacccgaatcgaagggtctgatc
gctctcttccgcggccagaccgagtgcaagaaaaatcgcttcggcaagcctcagcgcgcc
gtcaagactgtgggtgtgctgggcgctggtctcatgggtgccggcatcgtacaggtctcc
gtggacaagggctacaatgtggtgatgaaagacgcgaccgatgcgggtctggcacgcggc
atcgggcaggtgcagaagggcctggaaacggctgttaagcgcaagcgcatcacggctctg
gaacgcgaccagacgctggcgcatctgctgcccacacttaactacaacgacttcaagact
gccgacattgtgatcgaggctgtgtttgaggacatcaaaatcaagcatcgtgtgatcaag
gagctggaggccgtggtgccggagcactgcgtcattgccaccaacaccagcgccattccc
ataacaaagatagctgcgggcagctcacgacccgataaagtggtcggcatgcattatttc
tcgcccgtggacaagatgcagctgctggagatcattacacatccaggcacctccaaggac
accgttgctcaagctgttgccgtcggtctcaagcagggcaaggttgtgatcaccgtggga
gacggacccggcttctataccacgcgcattttggccaccatgttgtccgaagccataaga
ctgctgcaagagggcgtggacgccaaggaattggatcagttaactaagaagttcggcttc
cctgtgggcgctgccacattggccgatgaggttggcattgatgtgggctcccacattgcc
gttgatttggccaaatcattcggtgagcgcttcagtggcggcaacttggaagtcatgcag
gatctggtcttggcaggattcttgggccgcaaatccggcaaaggcattttcctgtacgat
ggccagagcaagggcagccgtccagtgaacactgaagccctggagattgtgaagcagaag
tactcgctagtgtccaagggcgccaatactcccgaggatttgacattgcgcatggtctcg
cgtttcgtcaacgaagctgtgctctgcctggaagagaagatcctcgacagcccattggaa
ggcgatgtgggcgctgtcttcggactgggcttcccaccatttacaggcggtcccttccgc
tgggtggatcagtacggcgccggcaagctagccagcaaaatgcagtcctacgccgagctc
tacggtgctcccttcaagccagcccaaacactgatcgacatggccaaggatccatccaag
aaattctatcccaagactaacgcagcgaagttgtaa

DBGET integrated database retrieval system