KEGG   Drosophila mojavensis: Dmoj_GI17596Help
Entry
Dmoj_GI17596      CDS       T01062                                 

Definition
GI17596 gene product from transcript GI17596-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dmoj_GI17596
Protein kinases [BR:dmo01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dmoj_GI17596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1027 aa AA seqDB search
MACFPRLFHHRSKNKFTPAEDENTDTILNTQDSPVEISLYVRREEEPLYSPIITPSTSEA
QLQRLKQQPSSSSSAQPLEAVVENVVSTKQEHQQQQQTKKFRSNRSRLQDKEKETDRPGG
PMANGSAINVTRNNSKLKPVKERRPTALPTEAPHMDGDGVQSDTDESHTTEEQELTQELA
QELAGNVVAGKSKLKGSLKGIIDESAGCNESVQQQTPSTATPSIFTPATPTKANVKFFIG
HTQVLNAEHDDTLSCHSNDDNNNNNNNSSSTSLKLTNGTLPTDRQQQRPVEPSSAPVEPS
KSYSNVSLNHLRRSKSTIATNEPTVTNNGQRRRVSTMPHINIPPPPPLPVELLKPVTPLH
LRKKRSTEPPAGTKELPPGDVPDGVVTQDEVGQRKDSDSGSKSSRRSSTAKAHRVEGGLI
YVRPNLPVQQNIEIEFNAKDEATRNLILEAIERNDFLNNLMDKERKDMVINAMAPASYKK
DSYIINEHDEGSEFFVSAEGYYDVIQAGKHVGNFGPATVFGELAILYNAPRKATIKAATD
ARVWKITRETFRAIMQISGSREREENLQFLRSAPFLQELDESLLNKVVDLLQRKFYETGS
CIVREGEVGNEFFIIRGGTVTIKKKDESKQEQVVARRKRGDYFGEQALMNADVRQASVYA
DAPGTEVLKLDREAFISYLGTIKQLSEKPQEQAIENGRASTRSTELDNEHAHIAISDLKK
VATLGAGAFGRVDLVTHNNQTFALKIIKKIEVVKQDQIEHVYNEKNVMIKCRASPFIVQL
YRTYRNEKYVYFLMEACMGGDVWTVMSKRQYFDDKTAKFIAGCVVEAFDFLHSHNFIYRD
LKPENLMLSSDGYCKLVDFGFAKYVRPNEKTNTFAGTPEYVAPEIILDRGHDRSVDYWAL
GILVYELLVGKTPFRGVNQVKIYQNILSGIDVIHMPSRIPKSAQNLIRHLCKQLPAERLG
YQRKGIADIKRHSWFDSLDWNRLKQKQLPSPIKRVLRSLTDLQYFMPLGVETDYEPPEEL
SGWDKDF
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctttccgcgtctcttccatcatcgcagcaaaaacaaatttacgccggctgaa
gatgagaacaccgacaccatactcaacacacaagacagtcccgtggaaattagtctctac
gtacgacgcgaggaggagccgctttactcgcccatcatcacgcccagcacgagtgaagcg
caactgcagcgcctaaaacaacagccctcctccagctcctccgcccagccgctcgaagct
gtggtcgaaaatgtggtcagcaccaagcaagagcatcagcaacagcagcagacaaaaaag
tttcgctcgaacaggagcagacttcaggacaaagagaaggagacggacaggccggggggg
ccaatggccaatggcagtgcaattaatgtcacacgtaacaattcaaaattaaaacccgtc
aaagaacgtcgccccacagcgctgcccaccgaggcgccccatatggatggcgatggtgtc
caaagtgacactgatgaaagtcatacaacagaggagcaggagctgacgcaggagctggcg
caggagctggctggcaatgttgtggctggcaagtcaaaactcaaaggaagtctgaagggc
ataattgatgagagtgctggctgcaatgagtcagtccaacagcaaactccatcgacagcc
acgccctcgatattcacaccagcgacgccgacaaaggcaaatgttaaatttttcattggt
catacacaggtactaaatgccgaacatgatgacactttgtcctgtcacagcaatgatgac
aacaacaacaacaacaacaacagcagcagcactagcctcaaactaacaaacggaacattg
ccaacggaccggcagcagcagcgcccggtagagccctcatccgcaccggttgagccctca
aagagctacagcaatgtctccctcaatcatctaagaagatcgaaaagcacgatagccacc
aacgagccaacggttaccaacaatggccagcgacgtcgtgtatccacaatgccacacatt
aacataccaccaccgccgccgttgccagtggagctcctaaagccggtcaccccactccat
ttgcgtaagaagcgaagcaccgaacctccggccggcaccaaggaactgccgccaggcgat
gtcccggatggtgtagtcactcaagatgaagtgggccagcgcaaggacagcgactcgggc
agcaagagcagccgtaggagctccacagccaaagcacatcgagtcgaggggggcctcatc
tatgtgcgaccgaatttgcccgtgcagcagaatattgaaatcgaatttaatgcaaaggac
gaagccacacgcaatctcatactggaggccatcgagcgcaatgatttcctcaataatcta
atggacaaggagcgcaaggacatggtcatcaatgcaatggccccggccagctacaagaag
gacagttacatcatcaacgagcacgacgagggctccgagttctttgtctccgccgagggc
tactacgacgtcatacaagcgggcaaacatgtcggaaatttcggcccggccacggtcttt
ggcgaactggcaatactctataatgcaccacgcaaggccaccattaaggctgccaccgat
gcgcgagtctggaagataacgcgcgagacatttcgtgccattatgcaaatctccggctcg
agggagcgcgaggagaatttacagtttctgcgctctgcgcccttcctgcaggagctcgac
gagagtctgctcaacaaagttgtggatctattgcagcggaaattctatgaaacaggcagc
tgcattgtgcgtgagggcgaggtgggcaatgagttcttcatcatacgcggcggcacagtg
accatcaagaagaaggacgagtccaagcaggagcaggtcgtggccaggcgcaagcggggc
gactacttcggagagcaggcgctgatgaatgcggacgtgagacaagcgagtgtctatgcc
gatgcgccgggcaccgaagtgctcaagctggatagagaagctttcatcagctacctgggc
accattaagcagctgagcgagaagccgcaggagcaggccattgagaatggccgagcgagc
actcgcagcaccgagcttgataacgagcacgcccacattgccatttcggatctgaagaag
gtggccacgctgggcgccggtgccttcgggcgggtggatctggtcacccacaacaatcag
acatttgcgctgaagatcataaagaagatcgaggtcgtcaaacaggatcaaatcgagcat
gtgtacaatgagaagaatgtgatgatcaaatgtcgcgcctcgcccttcatagtgcaactc
tatcgcacctatcgcaatgagaagtatgtgtactttctgatggaggcttgcatgggcggt
gacgtctggacggtcatgtcaaagcgtcagtatttcgatgataagactgccaaattcata
gctggctgcgttgtggaagcctttgactttctgcactcccacaacttcatctacagagac
ctcaagccagagaacctaatgctcagcagcgacggctactgcaagctggtggactttggc
tttgccaagtacgtgcgccccaacgagaagacaaacacatttgccggcacgccagagtat
gtggcgccagagataatattggaccgtggacacgatcgatccgtggactactgggcactg
ggaatactcgtctacgagctgctggtgggcaagacaccgttccgaggggtcaatcaggtg
aagatctatcagaacatcctcagcggcatcgatgtcatccacatgccctcgcgcataccc
aagtccgcccagaacctgatacgacacctgtgcaagcagctgcccgcggagcgactgggc
tatcagcgcaagggcattgcggacatcaagcggcacagctggttcgatagcttggactgg
aatcggctcaagcagaagcagctgccctcgcccatcaagcgcgtgctgaggagtctgacc
gacctgcaatacttcatgccgctgggcgtggagacggactacgagccgcccgaagagctg
agcggctgggataaggatttctga

DBGET integrated database retrieval system