KEGG   Drosophila mojavensis: Dmoj_GI17953Help
Entry
Dmoj_GI17953      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K06129  lysophospholipase III [EC:3.1.1.5]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00564  Glycerophospholipid metabolism
dmo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dmoj_GI17953
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dmoj_GI17953
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dmoj_GI17953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LCAT Hydrolase_4 Abhydrolase_1 DUF900 BAGE
Motif
Other DBs
NCBI-GeneID: 6577542
NCBI-ProteinID: XP_002003507
FlyBase: FBgn0140693
UniProt: B4KEP9
Position
Unknown
AA seq 421 aa AA seqDB search
MRLCSIIFAVLLFVALFSAGNCFWPFHKKGKHPPKPEPPKEKRLSPVIFVPGDGGSQLEA
RLSKSDSPYFICEKTHDWYNLWLDLEQLVIPMVYCWIDNVKLYYDKVTRTTHNTPGVETR
IPGWGDPEVVEWIDPTRNKAGAYFKDIANVLADLGYVRRLNIRGAPYDFRRAPNENKQFF
IDLKQLVEDTYEANNQTAVTFITHSMGSPMTLVFLQEQTAEWKAQYVRRQISLAGAWAGS
MKAVKVFAMGDDLDSFALSAKILRAEQISHPSTAWLLPSPLFWKPSEVLASTPSRNYTMA
QMKEFFHDIDYMTGWEMRKDTMRYTQNFSPPDVELHCLYGDGVSTVESLIYKKDTINGET
PKLKMGYGDGTVNQRSLRACQSWEGYSSSHISTLALQGVDHMGILVHPDVLQYIRTVMLQ
P
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagactctgcagcataatatttgcagtgctgctctttgtagcattgttcagtgctgga
aattgtttttggccttttcataaaaaaggcaaacatccaccaaaaccagagcccccaaag
gaaaaaagacttagtcctgttatatttgtacctggtgacggtggctctcaactcgaggca
cgcttgagcaaatcggactcaccctacttcatatgcgaaaagacacatgattggtataat
ctgtggctcgatctggagcaattggtcataccgatggtctactgttggatagataatgtg
aagctctactatgataaggtaacaaggacaacgcacaatacgccaggtgtggagacgcgt
atacctggctggggtgatccggaagtcgtggagtggatagatcccacgagaaacaaagct
ggagcctattttaaggatatcgccaatgtattggcagatctgggctatgtgcgccgttta
aatatccgtggagctccctacgactttcgacgggcgccaaatgagaataaacaattcttt
attgatctgaagcagctggtggaggacacatatgaagctaataatcaaactgccgttaca
tttataacgcacagcatgggcagccccatgactctcgtcttcttgcaggaacaaacagcc
gagtggaaggctcaatatgttcgtcgtcaaattagtttagctggcgcctgggcgggcagc
atgaaggcagttaaggtgtttgccatgggcgacgacttagactcgtttgctctgagcgcc
aaaatactacgtgccgaacagatctcgcatccatcgacagcttggctgctgccgtcgcca
ctgttctggaagccatctgaagtgctggcctcgactccatcgcgtaattacaccatggct
cagatgaaggagttcttccatgatattgattacatgacgggctgggaaatgcgtaaggat
acgatgcgctatacacaaaactttagtcctccagatgtggagttgcattgtttatatggc
gatggagtcagcacagtggagagtttaatatacaaaaaggatactataaacggggaaact
ccgaagcttaaaatgggctatggcgatggtaccgttaatcaacgttcgcttcgagcctgc
cagagttgggagggctacagctcctcccatatatcaacgctggctctacagggtgtcgat
cacatgggcattctggtccatccagatgtccttcaatatatacgcactgttatgctacaa
ccataa

DBGET integrated database retrieval system