KEGG   Drosophila mojavensis: Dmoj_GI18016Help
Entry
Dmoj_GI18016      CDS       T01062                                 

Definition
GI18016 gene product from transcript GI18016-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 484 aa AA seqDB search
MRTGLQRIENSVNFLKSVPLLRNLSDQLLAKIADVLELEFYAAGTYIIRQGTAGDSFFLI
SQGNVRVTQKLTPTALEETELRILGRGDYFGEQALINEDKRTANIIALAPGVECLSLDRE
SFKRLIGDLCELKEKDYGDEDRMLAMKQAQAQSEESFGAQAQQEYPDLKLTDLEVISTLG
IGGFGRVELVKAHHQGREDIFALKCLKKRHIVDTKQEEHIYSERSIMLSSNCPFICRLYR
TFRDDKYVYMLLEACMGGEIWTMLRDHGSFDDNAAQFIIGCVLQAFEYLHARGILYRDLK
PENLMLDERGYVKLVDFGFAKYIGNSAKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGI
LIHELLNGAPPFTAPDPMQTYNLILRGIDMITFPKHISRWAVHLIKRLCRDVPSERLGYQ
TGGIQDIKKHKWFLGFDWDGLSSQLLIPPFVRPIAHPTDVRYFDRFPCDPTEPPDELSGW
DADF
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccgggctgcagcgcattgagaatagcgtgaatttcttgaagtcggtgccgctg
ttgcgcaatctcagcgaccagctgctggccaagattgcggatgtgctggaattggaattc
tatgcggcgggcacgtatatcatacgccagggcacggcgggcgacagcttctttctcatc
tcccagggcaatgtgagagttacgcaaaagctgacccccaccgcgctggaggagacggag
ctgcggatcctgggtcgcggcgattactttggcgaacaggcgctcatcaatgaggataag
cgtacggccaatatcattgcgctggcgccgggcgtcgagtgcctcagcctggatcgagaa
tcgttcaagcggctcatcggcgatctatgcgagctgaaggagaaagattatggggatgag
gatcgcatgctggccatgaaacaggcgcaggcccagagcgaggagtcgttcggtgcgcag
gcacaacaggagtatccggatttaaagctaaccgatcttgaggtgatcagcacactgggc
atcggaggctttggtcgcgtcgagctggtcaaggcgcatcatcagggtcgcgaggacatc
tttgcactgaagtgcttgaagaagcgacacattgtggacaccaagcaggaggagcacatc
tacagcgagcgcagcatcatgctcagctcgaactgtcccttcatctgccgtctctatcgc
acattccgggacgacaagtacgtttacatgttgctggaggcgtgcatgggcggcgaaata
tggacgatgctgcgtgaccatggctccttcgatgacaatgcggcccagttcatcattggc
tgtgtcctgcaggccttcgagtacttgcatgcccgtggcatactctatcgggatctcaag
ccggagaatctcatgctggacgagcgcggctatgtgaagctggtggactttggctttgcc
aagtatattgggaatagcgccaaaacgtggacgttctgtgggacgcccgagtatgtggcg
ccagagattattctcaacaagggacacgatcgagccgtggactattgggctctgggcata
ctcatacacgagctgctcaacggcgctccaccgtttactgcgcccgatcccatgcagact
tataacctaatcctaaggggcatcgacatgatcacatttcccaagcacatctcacgctgg
gccgtgcacctgatcaagcgcctctgccgggatgtgccctccgaacgtttgggctaccaa
acaggcggcatacaggatatcaaaaagcacaaatggtttctcggcttcgactgggatggc
ctgtccagtcagctgctaataccgccctttgtgcggcccattgctcatcccacggacgtg
cgttactttgaccgttttccctgtgatcccactgagccgcctgatgagctttctggctgg
gatgcggacttttag

DBGET integrated database retrieval system