KEGG   Drosophila mojavensis: Dmoj_GI18029Help
Entry
Dmoj_GI18029      CDS       T01062                                 

Definition
GI18029 gene product from transcript GI18029-RA
Orthology
K10577  
ubiquitin-conjugating enzyme E2 I [EC:6.3.2.19]
Organism
dmo  Drosophila mojavensis
Pathway
RNA transport
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Translation; RNA transport [PATH:dmo03013]
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:dmo04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 159 aa AA seqDB search
MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKL
RMIFKDDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLL
NEPNIKDPAQAEAYTIYCQNRLEYEKRVRAQARAMAATE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaattgcaataacacgattgggcgaggagcgtaaggcttggcgaaaggatcat
ccatttggctttgtggcccgaccggctaaaaatcccgatggcacattaaacctcatgatc
tgggagtgcgctattcccggaaagaaatcgacaccctgggagggcggcttgtacaagctg
cgcatgatctttaaggatgattatccaacctctccaccaaaatgtaaatttgaaccgcca
cttttccatcccaatgtgtatccatcgggtaccgtatgcctctcgctgctggacgaggag
aaagactggcgtcctgctattacaatcaaacagattttgttgggcattcaagacttgtta
aacgagccaaacatcaaggatcctgcccaagcggaggcatacaccatttattgtcagaat
cgattggagtacgagaagcgagtacgtgcacaggcgcgtgccatggctgccactgaatag

DBGET integrated database retrieval system