KEGG   Drosophila mojavensis: Dmoj_GI18029Help
Entry
Dmoj_GI18029      CDS       T01062                                 

Definition
GI18029 gene product from transcript GI18029-RA
Orthology
K10577  
ubiquitin-conjugating enzyme E2 I [EC:6.3.2.19]
Organism
dmo  Drosophila mojavensis
Pathway
RNA transport
Ubiquitin mediated proteolysis
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmoj_GI18029
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmoj_GI18029
Enzymes [BR:dmo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     Dmoj_GI18029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 159 aa AA seqDB search
MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKL
RMIFKDDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLL
NEPNIKDPAQAEAYTIYCQNRLEYEKRVRAQARAMAATE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaattgcaataacacgattgggcgaggagcgtaaggcttggcgaaaggatcat
ccatttggctttgtggcccgaccggctaaaaatcccgatggcacattaaacctcatgatc
tgggagtgcgctattcccggaaagaaatcgacaccctgggagggcggcttgtacaagctg
cgcatgatctttaaggatgattatccaacctctccaccaaaatgtaaatttgaaccgcca
cttttccatcccaatgtgtatccatcgggtaccgtatgcctctcgctgctggacgaggag
aaagactggcgtcctgctattacaatcaaacagattttgttgggcattcaagacttgtta
aacgagccaaacatcaaggatcctgcccaagcggaggcatacaccatttattgtcagaat
cgattggagtacgagaagcgagtacgtgcacaggcgcgtgccatggctgccactgaatag

DBGET integrated database retrieval system