KEGG   Drosophila mojavensis: Dmoj_GI18080Help
Entry
Dmoj_GI18080      CDS       T01062                                 

Definition
GI18080 gene product from transcript GI18080-RA
Orthology
K08738  
cytochrome c
Organism
dmo  Drosophila mojavensis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dmoj_GI18080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 104 aa AA seqDB search
MGADAENGKKIFVQKCAQCHSYEVGGKHKQGPNLGGIVGRKCGSAPGYKYTEANIKKGIA
WTEGNLDEYLKDPKKFIPGTKMVFPGLKKAEDRADLIAFLKTNK
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccgatgcggagaatggcaaaaagattttcgttcagaaatgcgcacaatgccac
tcctacgaagtgggaggaaagcacaagcagggtcctaatcttggcggaattgttggccgc
aaatgcggttctgcccctggctacaaatatactgaagctaacatcaaaaagggtatcgct
tggacagaaggcaatctggacgagtatctgaaggatccaaagaaatttattcccggcacc
aagatggttttccccggactcaaaaaggccgaggatcgcgctgatttgattgcatttctc
aaaacaaacaaatag

DBGET integrated database retrieval system