KEGG   Drosophila mojavensis: Dmoj_GI18090Help
Entry
Dmoj_GI18090      CDS       T01062                                 

Definition
GI18090 gene product from transcript GI18090-RA
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dmo  Drosophila mojavensis
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dmoj_GI18090
Protein kinases [BR:dmo01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Dmoj_GI18090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1895 aa AA seqDB search
MSTSSIVQQFVNGLKSRNRNVQNKAAQDLFLYVKTELREMSQEELVQFFDDFDHHIFNMV
NAADINEKKGGALAMKCLISGDALITRKGISPYLNRLRDLLLINDVSVMEIAARSLVKLA
NMPGSKGAESFDFDIKKAFEMLSGDRQEYRRHAAVFILRELAIALPTYFYQQILTFFDHI
FNAIFDPKPAIRESAGEALRAALIVTVQRESTKQSSEPQWYKICYDEASSSFNTDVLPGK
EQKGMTRDDRIHGGLIVFNELFRCANANWERRYTTLKKLFPKSHHNKFLDTSSSSSVGSQ
LTTIVPRLKVPFVDKLGSTQMQMDSEQYNGIGNKLTSHNVLDSAYASEILKKHFKTICDN
VLEQRSSKSLYVQQGLLQILPRLAAFNREVFVAQYLETCIAHLMAILRGKEKDRNVAYIT
IGYIAVAVENDIEKHLKNIMASIKQALPAKDLTSKRKSTVDAAVFACITLLAHAVKSQIA
DDVREILEQMFHTGLSPALTVCLRELAENVPQLKAAITNGLIVVLFQVLMNKSATIPYAT
MPPITIDASLMLQTVDTATIVLALRTLGTFNFEEQNMLDFVQRCADYFIVHEQQEIRLEA
VQTCTRLLKLAVQSSESMENSKTLSDTVSHVIERLLSVAITDMDYNVRIRILRSLDETFD
AKLAQPESLNALFITLHDEIFEIRELAMVTIGRLSSMNPAYVMPKLRTTMIELLTDLKYS
GMSRNKEQSARMLDHLVISTPRLISSYMNPILKALVPKLHEPESNPGVVLNVLRTIGDLA
EVNGGSNEMELWADDLLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVTPYHKYPVL
IDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGKTDE
SQDISTAELLVNMGNALDEYYPAVAIAALMRILRDPTLSTRHTSVVQAVTFIFHTLGIKC
VPYLAQVLPNLLDNVRTADNNLREFLFQQLAILVAFVKLHIISYMDDIFKLIKEFWTINT
PLHSTLINLIEQIAVALGCEFRDYLAQLIPQILRVLQHDNSKDRMVTRRLLQALQKFGST
LGYYLPLIVPPIVKFFDSPYVPQQVSLAAMETINSLASQLDFTDFSSRIIHPLVRVLDTE
PELRDQAMTTLRSLVKQLGTKYLVFVPMVQRTISKHRIVDQEYDNLLTRIKSNSTLADAS
SFGSDFGQRQAKPKYNEPFVLDSNSSSKNLKVSTNALRTAWQVTRRVSKDDWMEWLKRLS
IGLLKESPSHALRACCVLAQDYDTLLRDLFNAAFISCWTELSPEHRYELTQSLIQALQVT
DMPEITQTILNLAEFMEHCDRAPIPIETQLLGTHAMACRAYAKALRYKEEEFVPRQEPHV
FESLIHINNKLQQREAAEGLLTTYRNSGNEASVHGRWYEKLHNWEQALHHYQLNLRADTN
DLEARLGHMRCLEALGDWSQLSNRCKEEWPNFSAEAKARASPLAAVAAWGLKDWEGMQEY
VRCIPVDTQDGSFYRAVLAVHHDDFETAQRLIDETRDLLDTELTSMAGESYERAYGAMVC
VQMLAELEEVIQYKLIPERREPLKAMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHEDIHT
WLKYASLCRKSGSLNLSHKTLVMLLGTDPALSPNDPLPCNQPQVTYAYTKYLAAASSKEL
AYKKLLDFVNTYSAQLNCVPPEAQKPQDQRLMARCYLRLATWQNKLHENRPNQEAVQGAL
ECFEKATDYDPNWYKAWHLWAYMNFKVVQSQKQALENPRQQSPATMGLGLDSEHLIIQQY
AVPAVQGFFRSISLIRGNSLQDTLRLLTLWFDYGNHAEVYEALFSGMKLIEINTWLQVIP
QLMHASTRIASWWVSLSISCSWTLAKITRRRLSIP
NT seq 5688 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacatcttcgattgtgcagcagttcgtcaacggactgaagtcccgcaaccgcaat
gtccaaaacaaggcggcgcaggatctgttcctgtatgtcaaaaccgagctgcgcgaaatg
tcgcaggaggagctggtgcagttcttcgatgacttcgaccaccacattttcaacatggtc
aatgcagcggatatcaatgaaaagaagggtggtgccctggccatgaagtgcctcataagt
ggtgacgctttgataacacgcaaaggcatctcaccttacctcaatcgtttacgcgatctg
ctgcttatcaacgatgtctcagtgatggaaattgcggctcgctctctggtaaagctggcc
aatatgccagggtcaaagggcgcagaatcattcgattttgatataaaaaaggcgtttgaa
atgcttagcggcgatcggcaggagtatcgccgtcacgctgccgtcttcattttacgtgaa
ctggcgattgcgttgcccacgtatttttatcagcaaattctaacgtttttcgatcacatt
ttcaatgccatctttgacccgaagccggcgatacgtgaatctgcaggcgaggcattgcgc
gccgcactcatcgtaactgtgcaacgtgagagcacaaagcaatcgagtgaaccgcaatgg
tataagatctgctacgatgaggccagcagcagcttcaacaccgatgtcctgccgggcaag
gagcaaaagggcatgactcgcgacgatcgcatacacggcggtctcattgtcttcaatgag
ttatttcgctgcgctaatgcgaactgggaacgtcgatatacaacgctcaagaagctgttt
cccaagtcgcatcacaataagttcctggacaccagcagctcctcatcagttggcagccaa
ctgaccactattgtgccacgcctcaaggtgcctttcgtcgacaaactgggcagcacccag
atgcaaatggatagcgagcagtacaatggcattggcaacaaattgaccagtcacaatgtg
ttggactcagcctacgccagcgagatacttaagaagcacttcaaaaccatctgcgacaat
gtgttggagcaacgttcatcaaagtcgctgtatgtgcaacagggactgcttcagatcctg
ccacgtttagctgctttcaaccgcgaggtgttcgtggcccagtacctggagacctgcata
gctcacttgatggccatattgcgtggcaaggaaaaggatcgcaatgtggcctacattaca
attggctacatcgccgtcgctgtcgagaacgatatagagaagcatctgaagaacattatg
gctagcattaaacaggcgctgcccgcaaaggatttgaccagcaaacgcaaatcgactgtg
gatgcagcggtgttcgcttgcatcacgctactggcccatgcggtgaaatcgcaaatcgca
gacgatgtacgcgaaatcctcgagcaaatgtttcacacgggtctctcgccagcgctgact
gtttgtctgcgcgaattggccgaaaatgtgccgcaactgaaggcagccattacgaatggc
ctgatcgttgtgctcttccaggtgctgatgaacaagtcggcgaccataccatatgccaca
atgccgccgattacaattgacgcctcgctgatgctgcagaccgtcgataccgccacaatt
gtgctggcgctccgtacactgggcacctttaatttcgaggagcagaatatgctggacttt
gtgcaacgatgtgcggattactttatagtgcatgaacagcaggaaattcggctcgaagcg
gtgcaaacgtgcacgcgcctgctcaagctcgccgtacagtcatcggagagtatggagaac
tcgaagacgttaagtgacacagtttcgcatgtgattgaacgactgctgtctgtggccatc
actgacatggattacaatgtacgcatacgcattcttcgctcgctggatgagactttcgat
gctaagctggcccagccggaatcgttgaatgcgctgttcattacactgcacgatgaaatc
tttgagattcgtgaacttgccatggtcacgattgggcggctgtcctccatgaatccggct
tatgtgatgcccaaactgcgcaccaccatgattgagctgctcacggacttgaagtactcg
ggcatgagtcgcaataaagagcaaagcgcacgtatgctggatcatctagtcattagcacg
ccgcgtcttatatcatcctacatgaatccgattctgaaggcgctagtgcccaagctgcat
gagccagaatcgaatcctggtgtagtgcttaatgtactgcgcacaatcggagatctggcc
gaggtcaatggcggctccaatgaaatggagctgtgggcagatgatctgctttccattctg
ctcgagatgctgggcgatgcgggcagtccggataagcgcggcgttgcgctctggacgctg
gggcagctgataagcgccacgggccgtgtggtcaccccctatcacaaatatccggtgttg
attgatatcctgatcaacttcctgaagaccgaacagcgtcgttccatacgtcgcgaaacg
atacgtgtgttgggcttgcttggtgccatggatccgtacaagcacaagatgaacaagggc
ctgatcgatagccagaaggataacgtgctgattgcctactcggacggcaagacagacgag
agccaggacatttccacggccgagctgcttgtaaacatgggcaatgctcttgatgaatat
tatccggcggtggccattgccgcactaatgcgcattctgcgcgatcccacgctgagcacg
cgccacaccagtgtcgtccaggccgtcaccttcatctttcacacgctgggcatcaagtgt
gtgccatatttggcacaggtgctgcccaatctgctggacaatgtgcgcaccgcggacaac
aatctgcgcgagttcctcttccagcaactggcgattctggtggcctttgtcaagctgcac
atcattagctacatggacgacatctttaagctgatcaaggaattctggacaatcaatacg
ccgctgcactccacgctgatcaacctaatcgaacagattgccgttgcgctgggctgcgag
ttccgtgactacttggcgcagctcataccgcaaattttgcgtgtactgcagcatgacaac
tccaaggatcgaatggtgacgcggcgactgctgcaggcgctgcagaaattcggcagcacg
ctgggctactacttgccgctgattgtgccgccgattgtcaagttctttgactcgccgtat
gtgcctcagcaggtgtccctggcagcgatggaaacgatcaacagtttggccagccagctg
gacttcacggacttctcctcgcgcatcatacatccattggtgcgtgtgctggacacagag
ccggagctgcgcgatcaggcaatgacaacgctgcgctccctggtcaagcagctgggcacg
aagtatctggtgtttgtgcccatggtgcagcgcaccataagtaagcatcgcattgtcgat
caggagtacgataatctgctcacccgcattaaatccaatagcactttggcggacgcctcg
agctttggtagtgattttggccagcgccaggcgaagcccaaatacaacgagccctttgtg
ctggacagcaacagcagcagcaagaatctgaaggtctcgacgaatgcgcttcgcaccgct
tggcaggtgacacggcgcgtctccaaggacgactggatggagtggctcaagcgattgtcc
ataggtctgctcaaggagtcgccctcgcatgcattacgcgcctgctgtgtgctggcccag
gattatgatacgctgcttcgggatttgtttaatgcggctttcatatcctgctggacggag
ctgtcgcctgagcatcggtacgagctaacccagtcgctcatacaggcgctgcaggtcacg
gacatgccggagatcacacagaccatactcaacctggccgagtttatggagcactgtgat
cgtgctcccattcccatagagacgcaattgctgggcacccatgccatggcctgtcgggcg
tacgcaaaggccttgcgttacaaggaggaggagtttgtgccgcgccaggagccgcatgtg
ttcgagtcgctgatccatatcaacaacaagttgcagcagcgcgaggcagccgaaggcctc
ctgaccacctatcgcaactcaggcaacgaggccagcgtccatggtcgctggtatgagaag
ctgcacaactgggagcaggcattgcatcattaccagctcaatctgcgagcggataccaac
gatctggaggcacgtcttggtcacatgcgctgcctggaggccctgggcgactggtcgcag
ttgagcaatcgctgcaaagaggaatggcccaacttcagtgcggaggccaaggcgcgtgcg
agtcccttggccgctgttgccgcctggggcttgaaggattgggagggcatgcaggaatat
gtgcgctgcatacccgtggacactcaagacggtagcttctatcgcgctgtgcttgcggtg
catcacgatgatttcgagacggcacagcgtctgattgatgagacgcgtgatctgctggac
accgaactgacctccatggctggggagtcctatgagcgggcctacggtgcaatggtctgt
gtgcaaatgctggccgagctggaggaggtgatacaatacaaactgataccggaacgacgg
gaaccgctcaaggccatgtggtggaagcgtctgcagggcgggcagcgtttggttgaggac
tggcgtcgcatcatccaggtgcattctctggttgtgaagccccacgaggatatacacacc
tggctcaagtatgccagcctgtgtcgcaagagcggctccttaaatttgtcgcacaagacg
ctagtgatgctgctgggcactgatccggcactctcgcccaatgacccactgccgtgcaat
cagccgcaggttacttatgcctataccaaatatctggccgccgcctcctccaaagagttg
gcgtacaagaagctgctcgatttcgtcaacacgtacagcgcccagttgaactgtgtgccg
ccggaggcacagaagccgcaggaccaacgtctgatggcgcgctgctatctgcgcctcgcc
acctggcagaacaaactgcacgagaaccgacccaatcaagaggcagtgcaaggtgccttg
gagtgcttcgagaaggcgacagactacgatcccaattggtacaaggcctggcatctgtgg
gcctacatgaacttcaaggtggtgcagtcccagaagcaggcgctggaaaatccacgccag
caatcgccggcgaccatgggcctgggcttggacagcgaacatctgatcattcagcagtat
gcggtgccggcggtgcagggattcttccgctccatcagcctcatccgcgggaattcgctg
caggacacgctgcgtctgctgacgctgtggtttgattatggcaatcatgctgaggtctat
gaagctctcttctccggcatgaaactgatcgagatcaatacttggctgcaagtgattcca
cagctaatgcacgcatcgacacgcatcgcaagctggtgggtcagcttatccatcagctgc
tcatggacattggcaaaaatcacccgcaggcgcttgtctatcccctga

DBGET integrated database retrieval system