KEGG   Drosophila mojavensis: Dmoj_GI18092Help
Entry
Dmoj_GI18092      CDS       T01062                                 

Definition
GI18092 gene product from transcript GI18092-RA
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dmo  Drosophila mojavensis
Pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dmo04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 450 aa AA seqDB search
MDLDRAWDIYYHVFQKISRQLPQLTSLELPYVSPKLMTCKNLELAVPGSYNPGQELIRIN
HIKTNLQVITSKQRPRKLCIRGSNGKDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPD
TFRRNLAIQRYAVIPLSTNSGLIGWVPHCDTLHTLIRDYRDKKKVPLNQEHRTMLNYAPD
YDHLTLMQKVEVFEYALSQTQGDDLAKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYIL
GLGDRHPSNLMLDRMSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEG
TYRRTCESVMLVLRRNKDSLMAVLEAFVYDPLLNWRLLDVDKKGNDTTTAGGASGGSPSN
SIEQESLLQGNPVAKSKTYEAQQLHGGYTNVADVTNSKASMVIQRVHRKLTGTDFQMSEM
TEQQQVELLIQQATNNENLCQCYIGWCPFW
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggatttggatcgtgcctgggatatatattatcatgtgttccagaagatttcacgtcag
ctgccgcagctgacatcgctcgaactgccttatgtgtcgcctaagctgatgacctgcaag
aacctggagctggctgtgcctgggtcctataatcccggccaggagctgatacgcatcaat
cacatcaagaccaatctgcaggtgatcacgtccaagcagcggccgcgcaagctctgcata
cgtgggtccaacggcaaggactacatgtatttgctgaagggtcacgaggatctgaggcag
gacgagcgtgtgatgcagctcttttcgctggtaaatacgctcctactcgacgatcccgac
actttccgtcgtaatctggccatccagcgctacgccgtcatcccgctgagcacaaactct
ggattgatcggctgggtgccgcactgtgatacgctacatacgctgattcgcgactatcgc
gacaagaagaaggtgccgctcaaccaggagcatcggaccatgctgaactacgcgcccgat
tacgatcatctgacgctgatgcaaaaggtcgaggtgttcgagtatgccctgagtcagacc
cagggcgatgatctcgccaagctgctgtggctgaagtcgccgtcgtcggagctgtggttc
gagcggcgcaacaattacacacgctcattagccgtcatgtccatggtgggctatatactc
ggtctgggcgatcgtcatccctccaatttgatgttggatcgcatgagtggtaaaatattg
cacattgattttggtgattgtttcgaggtggccatgacccgtgagaagttccccgagaaa
atacccttccgattgacacggatgctcataaaggcgatggaagtgacgggcattgagggc
acctatcgacgcacctgcgagagtgtcatgttggtgctgcgtcgcaacaaggactcgttg
atggctgtgctggaagcgttcgtctacgatccgctactcaactggcgtctgctcgatgtg
gacaagaagggcaacgacacaacaaccgccggcggtgccagcggcggcagtcccagtaac
tccatagagcaggagtcgctgctgcagggcaacccagtggccaaatccaagacgtacgag
gcacagcaactccacggtggatacactaacgtggccgatgtgaccaacagcaaggccagc
atggtcatacagcgagtccatcgcaagctaaccggcacagatttccaaatgtccgaaatg
accgagcagcaacaggtggagctgctcatacagcaggcgacgaacaatgagaacctctgt
cagtgctatattggctggtgtcccttctggtaa

DBGET integrated database retrieval system