KEGG   Drosophila mojavensis: Dmoj_GI18164Help
Entry
Dmoj_GI18164      CDS       T01062                                 

Definition
GI18164 gene product from transcript GI18164-RA
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     Dmoj_GI18164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 334 aa AA seqDB search
MSCNYAEGLSAYENKGILGAPENFDTEEVVNQKCKQLANLIKDSKHVVFHTGAGLSTSAG
IPDFRGPKGVWTLEEKGEKPTFNISFDEAKPTKSHMALKALIEHGYVQYIVSQNIDGLHL
KSGLDRKYLAELHGNIFIEQCQKCRRQFISQTTVATVGQKLLGRPCRSAEVGQSRSCRGG
IMQDNVLDWEHDLPERDLDMAFMHSTLADVNITLGTTLQIVPSGNLPLKNLKHGGKLVIC
NLQPTKHDKKAFLNISSYIDNILEKVCKRLGVEIPEYSEDCDPTKNDKISEWTLPQEYVK
ELDKQFKEYQKTFAKSNKNTLINKKLIKKRKRSE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtaactatgctgaaggtctttcagcttacgaaaataaaggaatcctcggtgca
ccggaaaacttcgacactgaagaagttgtgaaccaaaaatgcaaacagttggctaactta
attaaggattcgaaacatgtggtgtttcatacaggtgcaggtctcagcacctcagctggt
attcccgattttaggggacccaaaggagtctggacactggaagaaaaaggagagaagcct
actttcaatatatcttttgacgaggctaagccaacaaaatctcacatggcgttaaaagcg
ttaattgagcatggatatgtacaatatattgtgtcacaaaatatcgatggcttacatttg
aagtctggactagatcgcaagtacctggcggagctgcacggaaatattttcattgagcaa
tgtcaaaaatgtcgacgacagtttataagccagacgacggtagcaactgtggggcaaaag
ctattgggacgtccgtgcagatccgctgaagtaggccaaagtcgtagctgcagaggaggt
attatgcaggataacgtcttggattgggaacatgatctaccagaacgggacttagatatg
gcattcatgcattccactctagctgatgttaacattacccttggcacaactctgcaaatt
gtcccaagtggaaacttacctcttaaaaatctaaaacatggtggaaagcttgtcatttgc
aacctgcagcccacaaagcatgacaagaaagcatttttaaacatttcaagttatattgac
aatatattagaaaaagtttgcaaacgtttgggcgtcgagattcccgagtactccgaggat
tgtgatccaacaaagaatgacaaaatttcggaatggacgctgccgcaagaatatgtgaaa
gagttggataaacaattcaaagagtatcagaaaacatttgcaaaaagtaataaaaacaca
ctgataaataagaaacttatcaaaaagcgcaaacggagcgaataa

DBGET integrated database retrieval system