KEGG   Drosophila mojavensis: Dmoj_GI18202Help
Entry
Dmoj_GI18202      CDS       T01062                                 

Definition
GI18202 gene product from transcript GI18202-RA
Orthology
K10739  
replication factor A2
Organism
dmo  Drosophila mojavensis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dmoj_GI18202
   03420 Nucleotide excision repair
    Dmoj_GI18202
   03430 Mismatch repair
    Dmoj_GI18202
   03440 Homologous recombination
    Dmoj_GI18202
   03460 Fanconi anemia pathway
    Dmoj_GI18202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 242 aa AA seqDB search
MNDSFGDFNGTQTATAGATKESSGEGIISLLVKQILDSPEGNFKMFDVTYALVCVVGIVR
NVETSSTKITYTLEDHSGRIDAHYWLEEGDAIKAPDVMINNYVKIYGSVRPQAGQKVLMV
FKLINVLDPNEVCTHVLEALHSRYKAEEYHVKGNSSHAPSNSTMSNVSASQSNAIVAGLD
SKQLAVFQAIKSNCSEEGINRRELKAKFSHISQTELNNILDFMISEGHIYSSIDPDHFIC
TM
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcatttggtgatttcaatggcacacaaacggccacagcgggtgccacaaaa
gagtcttccggcgagggaatcatttctttgctggtgaagcaaatactcgattcgcccgag
ggcaacttcaagatgttcgatgttacctacgccttggtctgtgttgtgggcattgtgagg
aatgtggagacatcttcgacgaagattacctacaccttggaggaccacagtggacgcatc
gatgcacactactggttagaagaaggcgatgcgatcaaagcacccgatgtcatgatcaat
aactatgtaaagatctatggctcagtacgtccgcaggcgggtcaaaaggttttgatggtc
tttaagctgatcaacgtgctggatcccaatgaagtgtgcactcacgtactggaggctttg
cactcccgctacaaggccgaggaatatcatgttaagggcaattcatctcatgctccaagc
aattcgaccatgagcaatgtgtcggctagccagagcaatgctattgtcgctggcctggac
agcaagcagctggctgtcttccaggccatcaagagcaactgctccgaggaaggcatcaat
cgacgtgaactcaaagccaagttctcgcatataagtcaaactgaactgaacaacattttg
gactttatgatttccgagggacatatttactccagcatcgatccagatcattttatatgc
acgatgtag

DBGET integrated database retrieval system