KEGG   Drosophila mojavensis: Dmoj_GI18232Help
Entry
Dmoj_GI18232      CDS       T01062                                 

Definition
GI18232 gene product from transcript GI18232-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dmo  Drosophila mojavensis
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dmo04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 361 aa AA seqDB search
MPKFYKIEINRTEWEIPETYQNLQAVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVH
AKRTYRELCLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQK
LSDEHVQFLVYQILRGLKYIHSAGVIHRDLKPSNLAVNEDCELRILDFGLARPAESEMTG
YVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGT
PNDEFMNKISSESARTYIRSLPVMPRRNFRDVFRGANPLAIELLEKMLELDAEKRITAEQ
ALEHPYMEKWHDPSDEATSTLYDQSFEEDENTVEKWKEMVFTEVRRFKPPQAFAELLAQA
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagttttataaaattgagattaatcgcaccgaatgggaaattcctgaaacatac
caaaatcttcaggctgttgggcagggtgcctacggacaggtgtgcaaggccgtggtacga
ggtacctcaacaaaggtggctattaagaaattggcccgtccctttcaatcagcagtgcat
gcgaagcgcacataccgcgaactatgtctgttgaagcacatggatcacgagaatgtcatt
ggcctgctggatgtcttccatccagggcagccagctgattcgttagatcaatttcagcag
gtctacatggtgacgcatctgatggacgctgatctaaataatataatacgcacgcaaaag
ctatctgatgagcatgtgcaatttctagtctatcagatattgcgtggattaaagtatatt
cacagcgccggcgttattcatcgtgatttgaagccctccaatttagctgtaaatgaggac
tgcgagctacgtatcttagatttcgggctggctcgaccagcggagagcgagatgacggga
tatgtggcaacacgttggtatcgggcgcctgaaatcatgcttaattggatgcactacaat
cagacagtggacatttggtctgtaggctgtatcatggctgaacttttaacgggacgcacc
ctattcccaggcaccgaccacatacaccagttgaatctaatcatggaggtgctgggcaca
ccgaatgatgaatttatgaacaagatctcgtcggagagcgcacgcacttatatacgatcg
ttgcccgtgatgccgcgtcgaaacttccgcgacgttttccgcggtgccaatccactggcc
attgaattgctggaaaagatgttggaactggacgcggagaaacgcattacagccgagcag
gcccttgaacacccatatatggagaaatggcatgatcccagtgatgaagccacatcaacg
ctctacgatcaaagttttgaggaagatgaaaatactgtagagaaatggaaggagatggtg
ttcaccgaagtgcgacgctttaagccgccacaggcatttgccgagctcttagcgcaagct
caatag

DBGET integrated database retrieval system