KEGG   Drosophila mojavensis: Dmoj_GI18232Help
Entry
Dmoj_GI18232      CDS       T01062                                 

Definition
GI18232 gene product from transcript GI18232-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dmo  Drosophila mojavensis
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dmoj_GI18232
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dmoj_GI18232
Protein kinases [BR:dmo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dmoj_GI18232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 361 aa AA seqDB search
MPKFYKIEINRTEWEIPETYQNLQAVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVH
AKRTYRELCLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQK
LSDEHVQFLVYQILRGLKYIHSAGVIHRDLKPSNLAVNEDCELRILDFGLARPAESEMTG
YVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGT
PNDEFMNKISSESARTYIRSLPVMPRRNFRDVFRGANPLAIELLEKMLELDAEKRITAEQ
ALEHPYMEKWHDPSDEATSTLYDQSFEEDENTVEKWKEMVFTEVRRFKPPQAFAELLAQA
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagttttataaaattgagattaatcgcaccgaatgggaaattcctgaaacatac
caaaatcttcaggctgttgggcagggtgcctacggacaggtgtgcaaggccgtggtacga
ggtacctcaacaaaggtggctattaagaaattggcccgtccctttcaatcagcagtgcat
gcgaagcgcacataccgcgaactatgtctgttgaagcacatggatcacgagaatgtcatt
ggcctgctggatgtcttccatccagggcagccagctgattcgttagatcaatttcagcag
gtctacatggtgacgcatctgatggacgctgatctaaataatataatacgcacgcaaaag
ctatctgatgagcatgtgcaatttctagtctatcagatattgcgtggattaaagtatatt
cacagcgccggcgttattcatcgtgatttgaagccctccaatttagctgtaaatgaggac
tgcgagctacgtatcttagatttcgggctggctcgaccagcggagagcgagatgacggga
tatgtggcaacacgttggtatcgggcgcctgaaatcatgcttaattggatgcactacaat
cagacagtggacatttggtctgtaggctgtatcatggctgaacttttaacgggacgcacc
ctattcccaggcaccgaccacatacaccagttgaatctaatcatggaggtgctgggcaca
ccgaatgatgaatttatgaacaagatctcgtcggagagcgcacgcacttatatacgatcg
ttgcccgtgatgccgcgtcgaaacttccgcgacgttttccgcggtgccaatccactggcc
attgaattgctggaaaagatgttggaactggacgcggagaaacgcattacagccgagcag
gcccttgaacacccatatatggagaaatggcatgatcccagtgatgaagccacatcaacg
ctctacgatcaaagttttgaggaagatgaaaatactgtagagaaatggaaggagatggtg
ttcaccgaagtgcgacgctttaagccgccacaggcatttgccgagctcttagcgcaagct
caatag

DBGET integrated database retrieval system