KEGG   Drosophila mojavensis: Dmoj_GI18240Help
Entry
Dmoj_GI18240      CDS       T01062                                 

Definition
GI18240 gene product from transcript GI18240-RA
Orthology
K03099  
son of sevenless
Organism
dmo  Drosophila mojavensis
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmoj_GI18240
   04630 Jak-STAT signaling pathway
    Dmoj_GI18240
   04068 FoxO signaling pathway
    Dmoj_GI18240
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmoj_GI18240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1592 aa AA seqDB search
MFSSVGSHGISVGIASTVQDTDGYDFTKDENAARWRGLFIQSLRKVLEQVNPRVTAKEDA
LLYVEHLCVRLLAKLCAKPLPHSVQDVEVKVIKSFPSPLDQRALKEINELINSKKRKCLL
PTERVHTLLQKDVLQYKIDSSVSAYLVAVLECISSDILRTAADYVCRIAHSEIVKEDIEV
VLNADGMILDMLNSSGEELKCNVLPSPLSLPAQRASATYEETVKELINDEKQYQRDLHMI
IRVFREELVKIARDPKELEPIFSNIMDIYEVTVTLLGSLEDVIEMSQEQNAPCVASCFEE
LAEAEEFDVYKKYAHDVTSAASREALSNLLAKPDALSLMSAGHGFREAVKYYLPKLLLVP
ICHAFVYFDYIKHLMDLSTSQDDIESFAQVQGLLHPLHCDLEKVMANLSKERLLPVSGRV
RRQMAIERTRELQLKVEHWDDKDVGLNCNEFIREDALSKLGSGKRIWSERKVFLFDGLMV
LCKANTKKQTPSAGATAYDFRLKEKFFMRRVEINDRADTEELKHSFELITRMHPAIILSA
KNAQHKNDWMADLIMVNTKSMLDRILDSILQDIERKHPLRMPSPEIYKFAVPDSAENIVL
EERDSGVVPMIKGATLCKLIERLTYHIYADPTFVRTFLTTYRYFCSPQQLLTLLMERFEI
PEPSLVYQEQQQHSNNIGSNVNADLDKDAAATTVDSDKMLKNSQREDWKRYRKEFVQPVQ
FRVLNVLRHWVDHHFYDFEKDPTLLERLLQFLNEVNSKSMRKWVDSVRKIVDRKNKQSNK
KIVYAYGHDPPPIEYHLNVPDDEITLLTLHPLEVARQLTLLEFEMYKNVKPSELVGSPWT
KKDKELKSPNLLKIMKHTTNVTRWIEKSIMEAENYDERLAIMQRAIEVMMVMLELNNFNG
ILSIVAAMGTAAVFRLRATFNGLPERHRKFLDECRELSEDHLKKYQERLRSINPPCVPFF
GRYLTNILHLEEGNPDLLTNTELINFSKRRKVSEIIGEIQQYQNQPYCLNEEPTIRHFFE
QLDPFNGMSDKEMSDYLYNESLRIEPRACKTIPKFPRKWPNIPLKSPGIKPRRQNQNNNS
NKLPSNVAANVDPPPMAAAAAATTTTTTTTAVSSSSSIGDQSPQHNPHAYSVFAPVIIPE
RNGGHSWSSHAVQPRTTDNGEVAPAPHLPRKPAAHVWTQNNSYAPTEGFMPSDQQLPSAT
GSNWTMSDCYVISDTEAMPPSPLPKLMISPRHEATAPPPPPVPPASNRSPFHGRAAQTQY
SPTHSIASTVTLIGGGGLGDVSPQLGGFYCNSEQSQQQGQPQPGAVPISPHVNVPAANSM
EYRAVPPPLPPRRKERTESCADMAQKRQAPDAPILPPRDGELSPPPIPPRLNYSTAAGYG
RQPKEFVGKSSSLLLPNTSSIMIRRNSAKQPSLGVNTSGTSNNNNTNATIAAGSEDPQQQ
LQHQQLQQQQQQHQQQQQQLQQPPQSISPALSSSTTTSPMTPMTPMSPYIPSTVDGSSSY
PQQQYQLQQQHQNRHRPLTQSQQPPHHSNSHPHTHQHPSHHPNRRSSPKEFFPIATSHDG
TPKLPPKPSLSANFYNNPDKGTMFLYPSTNQE
NT seq 4779 nt NT seq  +upstreamnt  +downstreamnt
atgttttccagcgttggcagccatggaattagcgttggcattgcctccaccgtgcaggac
accgatggctatgacttcacaaaggacgagaatgcggcccgttggcgcgggttatttata
caatctttgcgcaaggtgctggagcaggtgaatccgcgcgtaacagccaaagaagatgcc
ttgctatatgtggagcatctgtgcgtacgcctgttggccaagctgtgtgccaaacccttg
ccgcattcagtgcaggatgtggaagttaaagtaatcaaatcattcccatcgccactcgac
cagcgcgcccttaaggagatcaacgagctaatcaattcgaagaaacgcaaatgtctgctt
ccaacagaacgtgtccatacgttgttgcagaaggatgtccttcagtataaaattgatagc
tcagtatcggcatatctagtcgctgtgctggaatgtatttcgtctgacatattgagaacg
gccgccgactatgtttgccgtattgcacacagcgagattgttaaggaggacattgaagtg
gtcttgaacgcggatggcatgatactagacatgctcaatagtagcggcgaggagctcaaa
tgcaatgtcctgccaagtccgttgtcgttgccggcgcaacgagcaagtgccacatatgag
gagacggtaaaggagcttatcaatgatgagaaacaatatcaaagggatttgcatatgatt
atacgtgtctttcgcgaagagctggtgaaaatagcgcgtgatccaaaggaactcgaacct
atattttccaacattatggatatatacgaggtgactgtgacgctgttgggctctctggag
gatgttattgagatgtcacaggagcagaatgcgccatgcgtggcgagctgtttcgaggag
ctagctgaggccgaggagttcgatgtgtataagaagtacgcgcacgatgtaacatcggcg
gcatcacgagaggcactcagtaatctactggccaaacctgatgcattgtcgttaatgtcg
gcgggtcatggttttcgagaggcagtcaagtattatttgcccaagctgctactggtgccc
atttgccatgcatttgtttattttgattatatcaaacatttgatggatctcagcacatca
caagatgacatcgagagctttgcccaggtgcagggactgcttcatccactgcactgcgat
ctcgagaaggtgatggccaatctgtcgaaggagcgacttttgccggtcagcggtcgcgtg
cgtcgacaaatggctatcgaacgcacacgtgagctgcagttgaaagtggagcactgggat
gacaaggacgtgggtctcaattgcaacgagtttataagggaggacgctctcagcaaactc
ggctccgggaaacgtatctggagcgagcgtaaggtgtttctttttgatggtttgatggtg
ctctgcaaagcgaatacgaagaagcaaaccccttcggcaggtgcgactgcatatgacttt
cgtttaaaagaaaagttctttatgcgtcgtgtggagatcaacgatcgtgcggacacggaa
gagctgaagcatagctttgagctaatcacacggatgcatcctgctattattttgtcagct
aagaatgcacaacacaaaaacgattggatggccgatttgataatggtgaacacaaagtca
atgctagatcgcatattggatagtatactgcaggatattgagcgcaagcatccgttgcgc
atgcccagcccggagatctacaaatttgctgtgcccgacagtgcagagaatattgtgctt
gaagaacgggacagtggggtggtaccaatgataaagggcgctactctgtgcaaactaatc
gaacggctgacctatcacatctatgcggatccaacatttgtgcgcaccttcctcaccaca
tatcggtatttctgttcgccccagcagctgctcactctgctaatggaacgtttcgaaata
cctgagcccagtttggtatatcaagagcaacagcagcattcaaataatattggcagtaat
gtcaatgccgatctcgataaggatgctgctgccacaacggtagatagcgataaaatgtta
aagaactcgcagcgtgaggattggaaacggtatcgcaaagagtttgtgcaaccagtgcaa
tttcgtgtgctaaatgtactaaggcattgggtggatcatcatttctatgattttgagaag
gacccaacattgctggaaagactgttgcagtttctcaatgaagttaacagcaagtccatg
cgcaaatgggttgactcggtgcgcaagatagtcgatcgcaagaataaacaaagcaataaa
aagatcgtttatgcctacggtcatgatccaccgcccattgaatatcatctgaatgtgcct
gatgatgagataacgctgcttaccctacatccactggaggtggcgcgtcaactcacttta
ctggagtttgagatgtacaagaatgtaaagccatcggaattggttgggtcgccctggacc
aaaaaggataaagagctaaagagtcccaatctgctaaagatcatgaagcatacgacaaat
gtgacgcgttggattgagaagtctatcatggaggcagagaactatgacgaacgcctggcc
atcatgcaacgagccattgaggtgatgatggtaatgctggagctaaacaatttcaatggc
atactctcgattgtggcagcgatgggcaccgcggctgtgtttcgtttacgtgccactttc
aatggactcccggaacggcaccgcaagttcttggatgaatgcagggagctgagcgaggat
catttaaagaaatatcaggagcgtttacgttccattaatccaccctgtgtgccatttttc
ggtcgctatctcacaaatatattgcatttggaggagggtaatccggatctgttgaccaac
acagagcttataaatttctcaaagcggcgaaaagtgtcggaaataattggcgaaatacaa
caatatcagaatcagccttattgcctgaacgaagagccaaccatacggcactttttcgag
cagctcgatccctttaatggaatgtcggacaaggagatgtcggattacttgtacaatgag
agtctacgcattgagccgcgcgcctgtaaaacaataccaaaatttccccgcaaatggcca
aacattccgctcaaatcgccgggcatcaaaccacggcggcagaaccaaaataacaacagt
aacaagttgcctagcaatgtggcagctaatgtggatcctcctccaatggcagcagcagca
gcagcaacaactacaacaactacaacgacagcagtcagcagcagcagcagtattggagat
caaagtccccagcataatccgcacgcatattcagtgttcgctccggtcataataccggag
cgtaatggcgggcatagctggagtagccatgcggtgcaaccacgcactacagacaatggg
gaggtggcgccggcgccgcatctgccccgcaagccggcagcgcatgtttggacacagaat
aacagctatgcgccaacggaaggatttatgccatcagatcaacagttgccatcagcaaca
ggcagcaactggactatgtccgattgttatgtgatttcggatacagaggcgatgccgcca
tcgcctttgccaaagctgatgattagtccgcggcatgaggcgacagcgccaccaccgccg
ccggtgccaccagccagcaaccgttcaccattccatggacgcgctgcacaaacgcaatac
agtcctacgcacagcatagctagcacggtgacacttattgggggcggtggcttaggggat
gttagtccgcaactggggggcttctactgcaacagtgaacagagccagcagcagggacag
ccgcaaccgggtgcggtgcccatatccccgcatgtaaatgtgccagcggccaatagcatg
gagtaccgagctgtgccgccgccgttaccgcctcgacgtaaggaacgcactgaaagctgt
gcggatatggcacagaagcggcaagctcctgatgcacctatactacctccgcgtgatggt
gagctaagtccgccgcccataccgcctcgcctcaactattccacggcagcgggctatggt
cgtcagcccaaggagtttgtaggcaaaagtagcagcttgttgttgccaaacacgagcagt
attatgatacgccgtaattcggccaaacaaccatcgctgggcgtcaatacgtcaggcacc
tccaataataacaacaccaatgcaacaattgcagcgggtagcgaagatcctcagcaacag
ttacaacatcagcagctgcaacagcagcaacagcagcaccaacaacaacaacaacaattg
cagcaaccaccacagtcaatctcgccagcactaagctcctcgacaaccacatcccctatg
acacctatgacgcccatgtcaccgtacattcccagcactgtagacggttccagcagttac
ccccaacagcaataccaactgcagcagcagcatcaaaatcgccatcggccgctaacgcaa
tctcaacagcccccgcatcattcgaattcgcatcctcatacgcatcagcatccatcacat
cacccgaacagacgctcgtccccaaaggaattctttcctattgccacgagccatgatggc
acacccaaacttccaccaaaacctagtctaagcgcaaacttctacaacaatccagataaa
ggtacgatgtttctttacccaagtacaaaccaagaataa

DBGET integrated database retrieval system