KEGG   Drosophila mojavensis: Dmoj_GI18259Help
Entry
Dmoj_GI18259      CDS       T01062                                 

Definition
(RefSeq) GI18259 gene product from transcript GI18259-RA (EC:2.7.11.24)
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dmo  Drosophila mojavensis
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Apoptosis - fly
Dorso-ventral axis formation
TGF-beta signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmoj_GI18259
   04350 TGF-beta signaling pathway
    Dmoj_GI18259
   04068 FoxO signaling pathway
    Dmoj_GI18259
   04150 mTOR signaling pathway
    Dmoj_GI18259
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dmoj_GI18259
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmoj_GI18259
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dmoj_GI18259
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dmoj_GI18259
Protein kinases [BR:dmo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dmoj_GI18259
Chromosome [BR:dmo03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     Dmoj_GI18259
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmoj_GI18259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 375 aa AA seqDB search
MAEGNAGTTAEGAAALAAPHPNAEVIRGQIFEVGPRYRKLTYIGEGAYGMVVSADDTLTN
QRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIEQMRDVYIVQCLM
ETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDF
GLARIADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIF
PGKHYLDQLNHILGVLGSPSQEDLECIINEKARNYLESLPFKPNVPWSRLFPNADPLALD
LLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFGINMENDDISRDALKSLIF
QETLKFKERQPEQAL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggaaatgctggaactactgctgagggtgccgctgctttggctgccccacat
cccaacgccgaagtcatcagggggcaaatttttgaagttggtccaaggtataggaaacta
acatatattggagaaggcgcatatggaatggtggtatccgctgatgacacgttgacaaac
caaagagttgctatcaaaaaaatttcaccctttgagcatcagacgtattgtcaacgaacg
ctaagggagataaccatattaacccgatttaaacacgaaaatattattgatatacgtgac
attctgcgagtagatagcatagaacaaatgagggatgtatatattgtacaatgcttaatg
gagactgatctgtataaactacttaaaacacagaggctgagtaatgatcatatctgttac
tttctgtatcagatattgcgtggtttaaagtatatccattcggcaaacgttttacatcga
gatcttaagccgagcaaccttttattaaacaagacatgcgatctaaaaatttgcgacttt
ggcttggctcgcattgctgatccagaccacgaccatactggttttcttacagaatatgta
gcaactagatggtaccgggcacctgaaatcatgcttaattcaaaaggatatacaaaatcc
attgatatctggtcggttggatgcattttggcagaaatgttaagcaaccgaccaattttt
ccgggaaaacattatctagatcaactgaaccatattcttggagtattaggttctccatcc
caggaagatttagaatgtattataaatgaaaaggcacgaaattatttagagtctttgcct
tttaaaccaaatgtgccatggtcgaggttatttccaaatgcggatcctttggctttggat
ttacttggtaaaatgttgacgttcaacccgcacaagcgtattccagtagaggaagctctt
gcacatccatatttagagcagtattatgatcctggcgacgagcccgttgcagaagtacca
tttggcattaatatggaaaatgatgatatatcgcgagacgctttaaaatcattaatcttt
caagaaacgttgaaatttaaagaacgacaaccagaacaggcgctataa

DBGET integrated database retrieval system