KEGG   Drosophila mojavensis: Dmoj_GI18264Help
Entry
Dmoj_GI18264      CDS       T01062                                 

Definition
GI18264 gene product from transcript GI18264-RA
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmoj_GI18264
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmoj_GI18264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 481 aa AA seqDB search
MPSFKVKVKWGRELYPDIDVNTDEDPILFKAQLFALTGVQPERQKIMCKGGILKDDEWNL
QLKDGAVVLLLGSKDKVPEMPQTPVKFIEDMNDAEAATAMRLPAGLTNLGNTCYMNATVQ
CLRAVPELRKALEKFQPDGSDATSYAFTISSAMKIVFAQMEKGTTITPIVLLQALHRASP
QFAQTGENGTYRQQDANECWSEILKMLQQKLLPLNQELGEATDKKVHNSFIEQFFGGTFE
VKMTADEAPDEPVTVSTENFLQLSCFISMEVKYMQSGLKSKMKEQLVKNSNTLGRDAHYT
RTYLISRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPIDFDAFELCTPDLQNKLCPMRA
KFKDHEDKKMDVESQINKTSKSLEVDGEDDETKYEPFWFDNDLGSNNSGYYTLKAVLTHK
GRSSSSGHYVAWVRSNGDVWYKFDDDDVTSVTTDEILRLSGGGDWHCAYVLLYGPKRLEK
C
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcttttaaagttaaagtcaagtggggccgtgaactatatccggatattgatgtc
aatactgatgaagacccaatattatttaaagctcaactttttgcattaacgggggttcaa
ccggaacgccaaaaaataatgtgtaaaggtggcatacttaaagatgatgaatggaattta
caattaaaagacggtgccgtagtcttattattgggttctaaggataaagtacccgaaatg
ccccaaacaccagttaaatttattgaagacatgaacgacgcagaagcagccaccgcgatg
cgcttacctgccggtttaactaacctcggcaatacatgttacatgaatgccactgtacaa
tgtttaagggctgttccggaactacgaaaagctttggaaaaatttcaacccgatggctct
gacgccacttcatatgcatttactatttcatcagctatgaaaatagtgtttgcacagatg
gagaagggaacaactattacaccaattgtgttgctgcaagccctacatagggcatcaccg
cagtttgcacagactggagaaaatggcacctatcggcagcaagatgccaatgaatgttgg
tctgaaatactgaaaatgttacagcaaaaacttttaccattaaaccaagagttaggtgaa
gctaccgataaaaaagttcataactcattcattgaacaattctttggtggaacttttgaa
gtcaaaatgactgcagatgaagctcctgatgagcctgttacggtttcaacagaaaatttt
ttgcagctcagttgttttatatcgatggaagttaagtatatgcaaagcggcctcaaatcg
aaaatgaaagagcaattggtaaagaactcgaatacgctgggtcgtgatgcacattataca
agaacttatttgataagtcgacttccagcatatcttaccgttcaatttgtcagatttcaa
tataaaggaaaggaaggcataaatgcaaaagtattgaaagatatcaaatttccaattgat
ttcgatgcatttgagctgtgtacgcccgatttacagaacaaactatgcccaatgcgagcc
aaatttaaggatcacgaagacaaaaaaatggatgtcgaatcacagataaataagacatcg
aaatctttggaagtcgacggagaagacgatgaaacgaaatatgagccattctggtttgat
aatgatttgggcagcaacaactctggttattatacacttaaagctgtgctaactcataag
ggtcgctcgagttcatctggtcattatgtggcctgggtacgctcaaatggtgatgtttgg
tataagttcgacgacgacgatgtgacatctgttaccactgatgagatattacgactgtct
ggaggtggtgactggcattgcgcttatgttctgttgtacggacctaaacgtttagaaaag
tgctag

DBGET integrated database retrieval system