KEGG   Drosophila mojavensis: Dmoj_GI18414Help
Entry
Dmoj_GI18414      CDS       T01062                                 

Definition
GI18414 gene product from transcript GI18414-RA
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
dmo  Drosophila mojavensis
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:dmo04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 256 aa AA seqDB search
MFKFVILLSVVACAFGAAIPEGLLPQLDGRIVGGTPTTIGSFPWQISLQRNGGHSCGGSI
YSSNIIVTAAHCLQGVSASSLKVRAGSSYWNSGGSLIQVAAFRNHEGYNPNTMVNDIAVI
RLSSSLSFSSNIKAIGLATYNPANGAAASVSGWGTQSSGSNSIPTQLQYVNVNIVSQSRC
ASSAYSYGSQIKNTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGVGCAYNNYPGVYA
DVAVLRSWVVNAANSV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagttcgtgattctgttgtctgtcgttgcctgcgcctttggtgctgctatccct
gagggtctcctgccccagttggatggtcgcattgttggcggcactcccaccaccatcggc
agcttcccctggcaaatctccctgcagcgtaatggcggccactcctgcggtggttccatc
tacagctccaatatcatcgtgaccgctgctcactgtctgcagggcgtgtccgcctccagc
ttgaaggtgcgcgccggttccagctactggaactctggtggctccctcatccaggtcgct
gccttcaggaaccacgagggctacaaccccaacaccatggtcaacgacatcgctgtcatc
cgcctgagctcttccctgtccttcagctccaacatcaaggctatcggtctggctacttat
aatcctgccaacggcgctgctgcttccgtctctggctggggcacccagtcatctggatcc
aactccatccccacccagctgcagtacgtcaatgtgaacattgtcagccagtcccgttgc
gcctccagtgcctacagctatggtagccagatcaagaacaccatgatctgcgccgctgcc
tccggcaaggatgcctgccagggtgactctggcggcccattggtttctggtggtgtcctc
gtcggtgttgtctcctggggtgttggctgtgcctacaacaactatcccggtgtctacgct
gatgtcgctgtcctccgctcctgggtggtcaacgcggccaactctgtctaa

DBGET integrated database retrieval system