KEGG   Drosophila mojavensis: Dmoj_GI18532Help
Entry
Dmoj_GI18532      CDS       T01062                                 

Definition
GI18532 gene product from transcript GI18532-RA
Orthology
K03115  
casein kinase II subunit beta
Organism
dmo  Drosophila mojavensis
Pathway
Ribosome biogenesis in eukaryotes
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    Dmoj_GI18532
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmoj_GI18532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 265 aa AA seqDB search
MSYNQVDTPDGTWIGWFVNLQVNRFLCRVPQEYIEDKFNLTGLDMLVPNFHQTLDAILDL
EFDTEYGFNPMDADPELTAQLYGLIHARYILSMRGIDDMCLKYQRGDFGICPRIYCDGQL
VLPVGMSDSVGESHVKVYCPRCRDVYQPHARCAHLDGAMFGTSFPHMFFMQLPHLLPEPP
LEKYTPRIYGFKLHKSALLPPEHPEPDIKNTISTDSVNNNNSNTNVSSGKSLPLIPMVSP
PAVKVSQNSSPTIGPPMHRFNFTIN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacaatcaagttgatacgcccgatggcacttggattggttggttcgttaatctg
caggtgaacagatttctgtgccgcgtgccccaggagtacatcgaggacaagttcaacttg
actgggctggatatgttggtgcccaactttcatcagacgctggatgccatactcgacctg
gagttcgacacggagtacggcttcaatccaatggacgcagaccccgagctgacggcccag
ctgtatggcctgatccacgctcgctacatactgagcatgcggggcatcgacgacatgtgc
ctcaagtatcagcgcggcgacttcggcatatgtccgcgcatctactgcgacgggcagctg
gtgctgccagtcgggatgtccgacagcgttggcgaatcgcatgtgaaggtctactgtcca
cgctgcagggatgtctatcagccgcatgcacgctgcgctcacctggacggcgccatgttt
ggcaccagcttcccccacatgttcttcatgcagctgccgcacctgttgccggaaccgccc
cttgagaagtatacgccacgcatctacggcttcaagctgcacaagtcagcgctgctgccg
cctgaacaccctgagcccgatatcaaaaacaccatttccacagacagcgtcaacaacaac
aacagcaacactaacgtcagcagcggcaaaagcttacccctcatcccaatggtctctccg
cccgccgtcaaagtgagccagaacagctccccaaccattggtccgcccatgcaccgcttt
aactttacaattaattaa

DBGET integrated database retrieval system