KEGG   Drosophila mojavensis: Dmoj_GI18532Help
Entry
Dmoj_GI18532      CDS       T01062                                 

Definition
GI18532 gene product from transcript GI18532-RA
Orthology
K03115  
casein kinase II subunit beta
Organism
dmo  Drosophila mojavensis
Pathway
Ribosome biogenesis in eukaryotes
Wnt signaling pathway
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:dmo03008]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dmo04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 265 aa AA seqDB search
MSYNQVDTPDGTWIGWFVNLQVNRFLCRVPQEYIEDKFNLTGLDMLVPNFHQTLDAILDL
EFDTEYGFNPMDADPELTAQLYGLIHARYILSMRGIDDMCLKYQRGDFGICPRIYCDGQL
VLPVGMSDSVGESHVKVYCPRCRDVYQPHARCAHLDGAMFGTSFPHMFFMQLPHLLPEPP
LEKYTPRIYGFKLHKSALLPPEHPEPDIKNTISTDSVNNNNSNTNVSSGKSLPLIPMVSP
PAVKVSQNSSPTIGPPMHRFNFTIN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacaatcaagttgatacgcccgatggcacttggattggttggttcgttaatctg
caggtgaacagatttctgtgccgcgtgccccaggagtacatcgaggacaagttcaacttg
actgggctggatatgttggtgcccaactttcatcagacgctggatgccatactcgacctg
gagttcgacacggagtacggcttcaatccaatggacgcagaccccgagctgacggcccag
ctgtatggcctgatccacgctcgctacatactgagcatgcggggcatcgacgacatgtgc
ctcaagtatcagcgcggcgacttcggcatatgtccgcgcatctactgcgacgggcagctg
gtgctgccagtcgggatgtccgacagcgttggcgaatcgcatgtgaaggtctactgtcca
cgctgcagggatgtctatcagccgcatgcacgctgcgctcacctggacggcgccatgttt
ggcaccagcttcccccacatgttcttcatgcagctgccgcacctgttgccggaaccgccc
cttgagaagtatacgccacgcatctacggcttcaagctgcacaagtcagcgctgctgccg
cctgaacaccctgagcccgatatcaaaaacaccatttccacagacagcgtcaacaacaac
aacagcaacactaacgtcagcagcggcaaaagcttacccctcatcccaatggtctctccg
cccgccgtcaaagtgagccagaacagctccccaaccattggtccgcccatgcaccgcttt
aactttacaattaattaa

DBGET integrated database retrieval system