KEGG   Drosophila mojavensis: Dmoj_GI18662Help
Entry
Dmoj_GI18662      CDS       T01062                                 

Definition
GI18662 gene product from transcript GI18662-RA
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 155 aa AA seqDB search
MPKTWPVYLLLSLLIALGARTIKGRQVKKCSLARQLYRNGVPYNELADWLCLVEGESSFN
TKAINPSNVDNSVDWGLFQINDRYWCKPSDGRPSTDLCRLPCRLLLSDDIRYSIACAKYI
KQQQGFSAWVAWNNRCQGPKPSVKRCFKRRHRYRG
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaacgtggccggtttatctgttgctctctttactgatcgcattaggtgcgaga
acgattaaaggtcgccaagtgaagaaatgtagcctagctcgacagctctatcggaacggg
gtgccttataacgagctagccgattggctgtgcctagtcgagggcgagagctcgttcaat
acaaaggctatcaatccaagcaatgtggataattccgtggactggggactgtttcagatc
aacgatcggtactggtgcaagccctcggatggcagaccttccacagatttgtgccgttta
ccctgccgactgttgcttagcgatgacattagatattccattgcctgtgcgaaatatatc
aaacaacaacagggattctctgcctgggtcgcttggaataatcgttgtcaaggtccaaag
ccaagtgtaaagcgttgctttaaacgaaggcatagatatagaggttga

DBGET integrated database retrieval system