KEGG   Drosophila mojavensis: Dmoj_GI18865Help
Entry
Dmoj_GI18865      CDS       T01062                                 

Definition
(RefSeq) GI18865 gene product from transcript GI18865-RB
  KO
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmoj_GI18865
Chromosome [BR:dmo03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dmoj_GI18865
   HAT complexes
    MOZ/MORF complex
     Dmoj_GI18865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 2308 aa AA seqDB search
MRESAHEISMDTWKQWILDAISKIRSQKQRPSVQRICQAIGTHHKFHEDIVAEKLEKAVE
SGSVIKVYNKGLHSYKAPMAKRRIKVDKTTNLYKVVAKAVNDLGECEGSTIKNIENYIQK
FNCIDLSPNVDFKAVIKASIKKAVDTGFLIQEGKLYKKGKSLTTPRKSAPETEILIKGEE
TCTHCSGNSQKNLNGIPEPLSSCKQCGISLHTTCANIAGKCKSQSYVLLYMLVTKGSLWN
CQKCADCVVCKMRNRGPCLLQCFACKNHFHLTCLDTIPDKKPKHPYRCKSCLNVDHPKSL
KREATNIKLEHDNERNVSYSNVSQKPHSNCKRQMIKREERLENPSTSQECVNNVAGHKQR
KKNSIVVNNYEAQMKQKKIYRDTIINQISRKRTYSDLSSTTTSSESDDDEDDDDDKNAAC
DDQDESTSSDSCTSSSSESDSSDSSSDSSECDDDNDEEDYDTDKSTFKENIFENEKNIDF
RSSSNDANSLVDASSENWGFAAVAKNPVDDKYIKNFKTMSYSNQSVANQAIDANKPNKYV
SDKSDNVVNGTLPIKRSNGNVEKKRTVILKSMPLESTKLYMKNDDDIPYLTKETVLKCRM
IEDQQFPESRKKPVESSISNNTDFTCIGNPADENVETVGPTKLFENQHLPPGVNQFDVNI
YQEVLQKAVLKVSANHSEMPLEKSNSLIHCGQSPKSIEIGKWNIETWYSSPFPQEYARLA
KLYLCEFCLKYTKSRSVLDRHQNKCIWKQPPGTEIFRQGDISVFEVDGNVNKIYCQNLCL
LAKFFLDHKTLYYDVEPFLFYILTKNDQVGCHLVGYFSKEKHCSQKYNVSCILTLPQYQR
QGYGRFLIDFSYLLSREEGQLGTPEKPLSDLGRLSYFSYWKSVVLEYLYKYRNNRTITFK
DIAIKTGLAISDIALAFELLNFIKLRKNDGDIRYQINVKIDWKKVLLHHKKRAQSKTRIF
IDPDCLRWSPLMSISKSPNFNIKPISNREYLSHQYMETSDDDFCKSKPEETTKPPANSTT
ESYKEKDLNKTFKPTSESTDKISHIKKDSHSESTQLPQTEAKRCKRAFEDITENSDSSDS
KYSKKSSESSEFNMLTKRALRLAKRKDSIPHTNKRKHFERDNNVDHVEHNVPSQSDQQNT
KETLDKSSVLQRATVQDVNVTKPVNIVPKLRGKKSNGKRDEESKAGSQNCNKIPLNENEN
AEVKKIIQDKQETEPEPQTVEKEKTPNDYCAEQVYDAVAKKTKKALFSETTPFEIKPTEN
TPPECKVEPKPTETEMVIESVSNSESKIQIPVKENIEPQKESSLVTPVEMEIEEKVPTIP
KAAPENAKVAPVVECTETAPIVNEEKLEKLEKLEPIKDPIVKSSEEKPIKPDEAPIPTEK
VATAAPTPVAAPVSTTPKPLEIVATKNSDTKETKVESKPCVILEQVETKIPEAPPIAVKC
TRQLNTEADKVNTTNEKLIPLKTEVPLVQEVDTKQKINNKKAALETSVARTENTNTNALC
KKPDAPNTGKMNVPDKDTNKPTQLLQVKEEEKPNVRVPSSSLPIRDKHQLKNNEHPQLQN
SLTSQFPINQMPNYHHTSQYWQWDYYSYNLCNSATQKGQKQFHKDLATTMAYTHNFTQNL
YQSANLAMQAHHQMHHPKDKQKVDRKISGKKEELAKAAANISTGNTARDDGHALNCNDYN
VNQANIYDQKCSNQQKQFKATDHNQQIKAIDNAQNPIARHANANQTESGILLSSSLSREP
SAAPTKQKSEHSSNIALGATRDDKIKVTQPILQSVNNHSNLQVSGQSDVNTNMPYNSESA
SNNAPIQQHYDCGINVQINMDSPASIGSAVNHGSENTNGLMHRQFSDCSMQNQSATTPMH
MSIQNSHIQQQNNINMNLTPEGSPNLNIIGNAQHQHQNRKLAVQQQTDIVASSPSASHRE
PTPKQIRNSNSSNNSQQRDSKVPTAGTTQNTHHQHSQSTVSNISKAQQQDGIGSLQFAQS
GGQHGHQQNMQPLDYIPIPQISQNFSTNPSNYDIVGMPAVIQQRMSLNSSVHSLSNSHQR
IEQPSSACAVNNFYLQNNMPSNEIVSNASRIPVSTTLGPPSSIANNDQSISSNSGGTTPA
VVGHLCSLSKLQQLTNCLESQPCNTSPGAQSNLAPSPHHPIPPNSMTPPPHLIMQNRNVS
TPPNMLQTQVTPLQYHKYYASNMNITPSTSTQNTNRNTRNTPSAPIQHTSAAISGSSNNR
TANVHISPNLMSHYGAINSYRMSPQQSPPATAYSSGGEYPNSQIPMQMGVMNMQSQYQDA
CVLQRATQPNPMYPTYSPYLGLNSSIRR
NT seq 6927 nt NT seq  +upstreamnt  +downstreamnt
atgagggaatccgcccatgagatcagtatggatacctggaagcagtggatacttgacgca
atatccaaaattcggtctcaaaagcaaaggccgagcgttcagagaatatgtcaggctatt
ggtacacatcacaagttccatgaagatattgtggctgaaaagttggagaaagccgttgaa
tctggctccgttattaaagtatacaataaaggattacattcatataaagcgccgatggcg
aaaaggcgaataaaagtcgataagacaacaaatctttacaaagtggtagcgaaagctgta
aatgatttgggagaatgcgaaggatcgacaatcaaaaatatagaaaactatattcaaaaa
tttaattgcattgatctttcgcccaatgttgatttcaaagctgtaattaaagcgtccata
aagaaagccgtcgacactggcttcctaatacaggagggaaagttatataagaagggtaaa
tcgctaacaacgccccgcaaatctgcaccagaaactgaaatacttatcaaaggcgaagaa
acctgtacacattgctccggaaattcacagaaaaatcttaatggcattccagaaccacta
agttcctgcaaacaatgtggaatatcattgcacacgacatgtgcaaacattgccggcaaa
tgcaaatcacaatcatatgtgctgctctatatgcttgtgactaaaggatctttatggaac
tgtcagaaatgtgctgattgcgttgtctgtaaaatgcgcaatcgcggcccgtgtcttttg
cagtgttttgcgtgtaaaaaccatttccatctaacatgcctcgatacgataccagacaaa
aaacccaagcatccatatcgatgcaaatcgtgcctaaacgttgatcacccaaaatcgttg
aaaagggaagcaacaaacataaaactggagcatgataatgagagaaatgtctcgtattcg
aatgtctctcaaaaaccacattccaattgcaaaaggcagatgattaagagagaagagcga
ctagaaaatccatcaacgtcccaagaatgtgtaaacaatgttgccggccacaaacagaga
aaaaaaaatagcattgtggttaataattatgaggctcagatgaaacagaaaaagatatat
cgagatacgatcattaatcaaatcagtcgaaagcgtacatactcggacttatcatctacg
actacttcaagcgaaagcgacgatgatgaggatgatgacgatgacaagaatgctgcgtgc
gatgaccaagatgagagcacgtcgtccgattcatgcacttcctccagctctgaatcagac
tcaagcgatagctcgagtgatagctctgagtgtgatgatgacaacgatgaggaggactat
gacacggacaagagtacattcaaagagaatatatttgaaaacgagaagaacattgatttc
cgatcatcgtccaatgacgcaaatagtttagttgacgcatcttcggaaaattggggattt
gctgccgttgctaagaatccagtcgatgacaaatatatcaagaattttaaaaccatgagc
tattcaaaccagtctgttgcgaatcaagcaatcgatgcaaataaacctaacaaatacgta
tcggataagtctgataatgttgtgaacggtactttaccaatcaagcgaagcaatggaaat
gtggaaaaaaagagaacagttatcttaaaatctatgccactggaatccacaaagttatac
atgaaaaatgatgatgatattccttatcttaccaaagaaactgtattaaaatgtcgcatg
attgaggaccaacaatttccagaatcgaggaagaagccagtcgaatcaagtataagcaat
aatacggatttcacttgtataggaaaccctgcggatgaaaatgtggagacagttggccct
actaaattgtttgaaaatcaacatctaccacctggcgtgaatcaatttgatgttaacata
tatcaagaagtgttgcaaaaagctgttcttaaagtttctgcaaaccattccgaaatgcct
cttgagaaaagtaattctttgattcactgtggacaaagtcccaaatcaattgaaattgga
aaatggaatattgaaacatggtactcaagtccatttccacaggagtacgctaggctggca
aaactctacctgtgcgaattctgcctaaagtatacaaagagtcgatcagtattggataga
catcaaaataaatgtatttggaagcaaccgcctggaactgaaatcttccgtcaaggcgat
atatctgtttttgaagtggatgggaatgttaacaaaatttactgtcaaaatttatgcctg
ctagcaaagttctttttggatcacaaaaccctttactatgatgtggagccctttctattt
tacatcttgactaaaaatgatcaggttggctgccatttggttggatatttttcaaaggag
aaacactgttcgcaaaagtacaatgtatcatgtattctgacattgcctcaatatcaaagg
caaggatatgggcgatttttgattgactttagctatttgcttagccgggaggaaggacag
ctgggcactccagagaaaccactctctgatcttggacgtctgtcgtacttttcatactgg
aaatcggttgtactagagtacttgtataagtaccgaaataatcggacaataacatttaaa
gatatagccataaaaacgggcttagctatttctgatattgctttggcatttgagttgcta
aacttcattaaactaagaaaaaatgacggcgacataagataccaaatcaatgtgaaaata
gattggaaaaaggtcttactacatcataaaaagagagctcagagcaaaacacgaatattt
attgaccccgattgtctcagatggagtccgttaatgtcgatttcaaaatcaccaaatttt
aatataaaaccaatatctaaccgtgaatatttgagccatcaatatatggaaacttcagat
gatgatttttgtaaaagcaaaccagaggaaactacaaagcctccagcaaattcaacgact
gaatcgtataaggaaaaagatttaaacaaaacatttaagccgaccagtgaaagtacagat
aagataagtcacattaaaaaggactcacactcggagtctacacaattaccacaaactgaa
gcaaaaagatgtaaacgtgccttcgaagatataacagaaaactccgattcttctgacagc
aagtattctaagaagtcatcagagtcgtctgaattcaatatgttgactaagcgagcgctg
cgtcttgctaagcgaaaggacagtattcctcataccaacaaaaggaaacattttgagaga
gataataatgttgatcatgtggaacataatgttccaagtcaaagcgatcaacagaatact
aaggaaactttagataaaagttccgtcttacaacgagctactgtccaggatgttaatgtt
acgaagcctgttaatattgtgcctaagctgcgaggtaaaaaatcaaatggaaaacgcgat
gaagaaagtaaagctgggagtcaaaactgtaataaaattccattgaatgagaacgaaaac
gccgaggtgaagaaaatcattcaggataagcaggaaaccgagccagagccccaaacagtt
gaaaaagaaaagaccccaaatgattactgcgcggaacaggtctacgatgccgtcgcaaag
aaaactaagaaggcattattttccgaaaccactccgtttgaaataaagcctactgagaat
acacctcccgaatgcaaagttgagccaaagccaactgaaactgaaatggtaattgaaagc
gtatcaaacagcgagtcgaaaatccaaatcccagttaaggaaaacatcgagcctcaaaaa
gagtccagcttagtgactcctgtggaaatggaaattgaagaaaaagttcccactattccc
aaggctgctcctgaaaacgctaaagttgcaccagtagtggagtgtactgaaacggcacct
attgtgaatgaagaaaaattggaaaaattagaaaagttggagccaatcaaagatccaata
gttaagagctcagaggaaaaacccataaaacctgatgaggctcctattcctacagaaaaa
gtggctaccgcagcgcccactccagtagccgctccagtttctactaccccaaagcccttg
gaaatagtggccacaaaaaactcggatactaaagagactaaagtggagagtaagccctgt
gttattcttgagcaagtggaaacgaagattcccgaagctcctcctattgctgttaaatgc
actcggcaattaaatactgaagctgacaaggtaaatacaacaaacgaaaagctgatccca
ttgaagacagaagtgccgctagtgcaagaggttgatacaaagcagaaaataaataataaa
aaggcggctttggaaacctcagtagcgaggaccgagaataccaataccaatgcattgtgt
aaaaaaccagatgctccaaataccggtaaaatgaatgttccagataaggacacaaataaa
ccgacccaattactgcaagtcaaagaagaggaaaagcccaatgtgcgcgtcccgtcgtcc
tcattgccaatacgggacaaacatcaactgaaaaacaacgaacatccccagctgcaaaac
tctttaacttctcagttcccaatcaatcaaatgcccaactaccatcacacttcgcagtac
tggcaatgggactattacagctataatctgtgtaattcagccacccagaaaggtcaaaaa
caattccacaaagacctggctacaacaatggcctacacgcacaacttcacacagaacttg
taccagtcggcgaacttggcaatgcaagcccatcaccagatgcaccacccaaaggataag
cagaaggttgatcgaaaaataagcggcaaaaaggaggagttggcgaaagcagcagccaac
attagcactggcaacacggcaagagacgacggccatgcactcaactgcaatgattacaat
gtcaaccaggccaacatttatgaccagaagtgctccaaccaacaaaaacaatttaaagca
acggatcataaccagcaaatcaaggccatagataatgctcaaaaccctatagccagacac
gcgaatgccaaccaaacggagtcgggaattctgctgtcaagttctttgagccgcgagcct
tctgccgcgcccacaaagcagaaatcggagcacagtagcaacatagctctaggcgctaca
cgagacgataaaattaaagtaactcaaccgattctgcaatcggtcaataaccattcaaat
ttgcaagttagcggtcaatctgatgttaataccaatatgccgtacaactcagagtcggcc
tcgaacaatgcacccatacagcagcactatgattgtggtattaatgtgcaaataaatatg
gattcgccagcaagtattggcagtgccgtcaatcatggatcggaaaacaccaatggactc
atgcacagacagttctccgactgttccatgcaaaatcagtcggccacgacgcccatgcac
atgtccatccagaactcacatatccagcagcagaacaacatcaatatgaatttaacacca
gaaggctcgcccaatttaaacatcatcggcaatgcacagcaccagcaccaaaatagaaaa
ctagcagtacaacagcagacggatattgttgcgagttccccgagtgcatcacaccgagag
ccgacacccaagcaaattcggaatagtaattcatcaaataattctcagcaacgcgactct
aaggttccgaccgcaggaactacgcaaaatactcaccatcaacactctcagagtactgtt
tcaaatatatcgaaggcacagcaacaagatggcataggcagcctgcagtttgcgcaatcg
ggaggacagcacggacatcagcagaatatgcagcccttggactacatacctattccgcag
attagtcaaaacttttcaacgaatccatcaaactatgacatagtcggtatgccggctgtc
attcaacaacggatgtctctgaatagctcagtgcattctctatcgaactctcatcaacgc
attgagcaaccttcgtcagcttgtgctgtaaataatttttatttacaaaataatatgcca
tccaatgaaatcgtatcgaacgcatctcgtataccagtgtcaactaccttagggccccca
tcttccatagctaataatgatcagtccatatcatcgaacagtgggggaacgacgccagct
gtagtcggtcatttatgtagtctttcgaaactccaacagcttactaattgccttgaatct
cagccatgtaatacgtccccgggagcacaatcgaatttagcaccatcgccgcaccatcca
attccacccaattctatgacaccacctccgcatttgataatgcaaaacaggaacgtttcg
acgcctccaaatatgctacagacacaagtaactcccctccaatatcataaatattatgca
agcaacatgaacatcacgccgagcacatcaacgcagaacactaacagaaacactcgaaac
acaccatctgcccccattcagcatacctcggcggcaattagcggtagttcgaacaaccgc
acggcgaatgtccacatcagtcccaatctgatgtcacactatggcgccatcaatagctat
cgaatgtcgccgcagcagagtcctcctgccacggcgtacagttcgggcggcgaatatccc
aattctcagattccaatgcaaatgggcgtaatgaacatgcaatctcagtaccaggacgcg
tgcgtgttacagcgagctacgcagcccaatccgatgtatccaacgtactcgccatacttg
gggttgaacagctcaatacgcagataa

DBGET integrated database retrieval system