KEGG   Drosophila mojavensis: Dmoj_GI18913Help
Entry
Dmoj_GI18913      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     Dmoj_GI18913
Peptidases [BR:dmo01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   Dmoj_GI18913
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Dmoj_GI18913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 415 aa AA seqDB search
MYELHSCLNLVFYATIIPGTILISWLTGLVGLPCLVIALLVFFLFFVLLPLAFRTSVTLQ
RGILFLTFITYPKGLDLSKPHSIGLFATRNFYITVKDHDEDEDGVRIGVWHVLPRYAVHR
FRRELRVEADVETAFSNSQQFMPTHQSPDSHELERLAPELRAEFPVIVPENEQLFYERLL
RVPGGTVVLYLHGNTATRGSGHRSEVYKLLRHLNYHVFSFDYRGYADSDPVPPSEDGVVR
DALMVFEYIANLTSNPIFIWGHSLGTGVATHMCAKLAHMKERGPRGVILESPFTNIRDEI
RLHPFSRPFRHLPWFDYMISQPMYDNRLRFESDKHVGEFPQPIMIMHAEDDVVVPFRLGY
QLYRTALDTRRRSWGPVEFHRFDRTHGYGHKYLCRAPELPGLVEQFIESYRNTIY
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagcttcatagttgtttaaatttagttttctatgcaacgatcattcccggaacg
attctcattagttggctgactgggctagtcggtctaccctgcctggtgatagctttgctg
gtgttcttcctcttctttgtgctgttgccgttggctttccggacatctgtgacgctgcag
cgtggcattctgttcctcacatttatcacctatccgaagggccttgacctgagcaaaccg
cacagtattggactttttgccacacggaacttctacatcactgtcaaggatcacgatgag
gacgaggatggtgtgcgcattggcgtctggcatgtgctgcccaggtatgctgtgcaccgt
ttccgccgagagctccgcgtggaagctgacgtggagacggctttttccaacagccagcaa
tttatgcccactcaccagagtcccgacagccatgagctggaacgtctagcgccagagctg
cgtgccgaatttcctgtaattgtgccggaaaacgagcagctcttctacgagcggctgctg
cgtgtgcctggcggcactgtggttctctatctgcatggcaatacggccacgagaggcagt
ggccatcgttccgaggtgtacaagctgttgcggcatctgaattatcacgttttctcattc
gactatcggggctatgctgactcggatccagtgcctccgtcagaggatggcgtggtgcgg
gatgctctgatggtctttgagtacattgccaatttgacgtcgaatccaatcttcatctgg
ggccactctttgggcacgggcgtagccacgcacatgtgtgccaaactggcccacatgaag
gagcgtggaccacgcggcgttatacttgagagtccgttcaccaacattcgtgatgagatc
cgtctgcatccgttctcgcggccgttccgacatttgccctggttcgactatatgatctcg
cagcccatgtatgacaaccgactgcggttcgagtcggacaagcatgttggcgagtttcct
cagccaattatgataatgcacgccgaggatgatgttgtggtgcccttccgtttgggctac
caactctatcgaactgcactggatacgcgcaggcgctcctgggggccagtggaattccat
cggtttgaccggacacatggatacgggcacaagtatttgtgccgggctccagagctgcct
ggtctggtggaacaatttatagagagctatcgcaatacaatttactag

DBGET integrated database retrieval system