KEGG   Drosophila mojavensis: Dmoj_GI18963Help
Entry
Dmoj_GI18963      CDS       T01062                                 

Definition
GI18963 gene product from transcript GI18963-RA
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 461 aa AA seqDB search
MNVAAGGTSAAAGSASNNNALPMAQLADGWLELESDPGLFTLLLEDFGCHDVQVEEVYDL
QKPIESPYGFIFLFRWIEERRARRKIVETTAEIFVKDEEAISSIFFAQQVVPNSCATHAL
LSVLLNCNENNLQLGETLSRLKAHTKGMSPENKGLAIGNTPELACAHNSHAMPQARRRLE
RTGAGVASCRFTGEAFHFVSFVPINGQLFELDGLKPYPMNHGCWEEHEDWTDKFRRVMAD
RLGIATGEQDIRFNLMAVVPDRRIAITHKLKMLRTNQAIVSGTLQKLLKADEQGDDQQRP
DTPNTLLEPSAFTARDLQSLLKNLDTEIAINEQHLADENDRRQMFKVDASRRTHNYDKFI
CTFLSMLAHQGVLGELVSQHLLPTKKISGQSAANRLSKQSSAATANTANSAANATAGKSQ
PQQQQQQQQQQPQSQAAKNGKSPGKTPGRRRKGRNKCRKRK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcgcagccggcggcaccagcgcagctgcaggcagcgcctcaaacaacaatgca
ctgcccatggctcagctagccgatgggtggttagagctagaatcagatccgggtctcttt
acgctgctcttagaagattttggctgtcacgacgtacaagtcgaagaggtatatgactta
caaaagcctatagaaagtccatacggcttcatttttctttttcgctggatcgaagagcgt
cgcgcacgccgaaaaattgtagagacaacagccgagatatttgtcaaggatgaggaagcc
atctcaagcatcttctttgcccagcaggtggtgcccaatagttgtgctacccatgctttg
ctctctgtgctgctcaactgcaacgaaaacaatctgcagctgggcgaaacgttgagtcgc
ctcaaggctcacactaagggcatgagcccggagaacaagggtttggccattggcaataca
ccagaattggcatgcgcccacaactcgcatgccatgccccaagcgcgtcgtcgtctggaa
cgtacaggtgctggtgtggccagttgtcgatttacaggggaagcatttcattttgttagc
tttgtgcccatcaatgggcagctgttcgagctggatggtctgaagccgtatccaatgaat
catggctgctgggaggagcatgaggattggacagacaagttccgtcgcgtaatggctgac
cgtttgggcatcgcgactggtgagcaagacattcgctttaatctgatggccgttgtgccc
gatcgtcgcatcgccatcacccataagctaaagatgttacgcaccaatcaagccattgtg
tcgggcacgctgcagaagctgctcaaagcggatgagcagggcgacgatcagcagcgtccg
gatacgcccaatacgctgctagagccgagtgcctttacagcacgcgacctgcaatcactg
ctcaagaaccttgatacggaaatcgcgatcaatgagcagcatttagctgatgagaacgat
cggcggcaaatgttcaaagtggacgccagtcgtcgcacccacaactatgacaaattcatc
tgcacttttctctccatgctggcacaccagggcgtgctcggcgagctagtcagccagcat
ttgctgcccaccaagaagataagtggacagagcgccgcgaatcgactcagcaaacagagc
agcgccgccacagctaatacggcaaatagcgctgcgaatgccacagcaggaaaatcccag
ccgcaacaacagcagcaacagcaacaacagcagccacaatcgcaagcggcgaagaatgga
aagtcacctggaaagacaccgggtcgtagacgaaagggtcgaaataagtgcagaaagcgc
aagtga

DBGET integrated database retrieval system