KEGG   Drosophila mojavensis: Dmoj_GI19228Help
Entry
Dmoj_GI19228      CDS       T01062                                 

Definition
GI19228 gene product from transcript GI19228-RA
Orthology
K04437  
filamin
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1617 aa AA seqDB search
MDVKGIKGAKVTHAGLLKHNSDGTTETQKITHAGLVARSPEGTAAKGMNIRGNEDLWVEI
QANTFRNWVNEHLRETGMQVHDWATDFCDGTCLCALVENLQTRPLKPSWNRRPANQHHYL
ENATTALKSIEADHIKLVNIGNVDIVNGNVKLILGLIWSLIVRYQIGRSKFPPRKLMLAW
LQAALPDCKITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCTNAMNLAQRE
FGVPKVLEPEYLASPWLDELSGMTYLSYFMKPGGPGYNATMRWVNTQVKEPVKNFTTDWN
DGRVLCEVIKGLGGSAPAPDKLSTDPFHFENNIRKAVDAGAKLGVQPILTPKDMANPEVE
HLGIMAYAAHLQWVPPRPPLSDLVNVYLESTSGRVGEPTHFRIDVLSRDVSLSSVRCHVV
PPSGQPGQSVRLNVHGEGVYVPERYGMHEIVVEIGEDSLGGHFFRVLPRLLQVAPPGMAP
CALGSLVEVLVNATGAPKTEDILVTAVSPTGISHNCPLKKIDEGHSAIFKPDEAGIWEIA
ITYQGRHIQGGPFTCAVFDASGVSVHGLDGAMPLRAHTFEVDARGVGVNGELHVDIVHDK
HSLVCSLEKIVDNKYRVTFMPRQNGKYRVYIYFNGYDVKGSPFIMRVGTKGRSGKTRSSP
LHESKHRSESPSMHFISTTNTRHNDYRNSSLNRRDLHTHNTAERTSSYSPQYSPKLDTTD
YHSSSSRYYKRESEENNGPSPTPNSPTVKYLNSADLYTETGGARRDSKASNSSSTKNDYY
YDKENELYSQRRIVSKPKLTPPREEREQLNGIGISSSSNSYQRHQQQQQLTSSLSPIPSP
TLNTRSSEVHSHSPLTIKTSNQFESSTRNITSSPRHASASPVQRYSPNNAYISTATHRIG
SPVTSTLNKNGYESTRVEKSSTYKSTSNYVTDSSVRASPSLYGTAERLRRTGSPEPRIDH
SSNVRVSSMKPASARRDSWDVINKTKHMLSHNSLESLANMTETQLNTELNYTRPDLDNET
QRNTQYNKFALHKQQQQQQQHHQTDYRRDSPDDVDRYKPSAITVKSHSNNTYTDKSGGYT
KTVKESSEHIVTESNGHSLTSAPGYGYSSLSRFRPIDSNATGARAIRVQDIPNGSIGRPV
EFEIDGSKAGSGNLEILVNGGRVTSSVRSLGGQRFIASFTPHEHGTHTVQITFNGETVPG
SPWHAEIMSSPGLTALGESTRLVPANTPAVFEILPPPGQSLSKGECVATVLTPNKSKLNA
RVTHEAANGAARIEFVPTEVGTHIIDASINGTKIAGGPLIAKVYDASLIQVTEVNGGVVG
QPCQFRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKSHLIDIKFNGET
VRGCPFVCAVADTSRVLLNLSNLELIPVNRPSSFHITVSGGGAAELAVSVRGPHGELPVR
VTGDIHAGFTAEFTPTSVGGHSINVEYNGFAVQGTPFLAKSYDASKVVVGSVSRGTMGRP
VQFTVDAGDAGEGNLEITISAKGQNIPTQVHPQGSARFSVSFVPTESCEHTINVSFNKMP
VPGCPITVGISGGVAGPQVSLGGPGPVHQTNSFVINHNGGRLEDIEVNVEGRRKLLY
NT seq 4854 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaaaggcatcaagggcgccaaggtgacgcacgcgggcctgctcaagcacaac
agcgacggcaccaccgagacccaaaagatcacacatgccggcctggtggctcgcagtccc
gagggcaccgccgccaagggcatgaacatacgcggcaacgaggatctgtgggtggagatc
caggcgaacacctttcgcaactgggtcaacgagcatctgcgcgagacgggcatgcaggtg
catgactgggccacggacttctgtgacggcacctgcctgtgcgccttggtggagaacctg
cagacgcgtccgctgaaaccgtcgtggaaccgtcggccggccaatcagcatcattatctg
gagaatgccacgacggcgctcaagtcgatcgaggcggatcacatcaagctggtcaacatc
ggcaacgtggacattgtcaatggcaatgtgaagctgatactcgggttgatctggtcgctg
atcgtgcgctatcagatcggacgcagcaaattcccgcccaggaagctgatgctggcctgg
ctgcaggcagcgctgcccgactgcaagatcaccaatctgaccaccgattggaatagcggc
gtcaacctggccgcactgctggactactgtcagccgggcctgttcccgcactggcgcagt
ctcgatcctagtcagagtgtgcgcaactgcaccaatgccatgaatctggcgcagcgcgag
tttggtgtgcccaaggtgctggagccggagtatctagcctcgccctggctggacgagcta
tccggcatgacgtatctctcgtacttcatgaagcccggcggacctggctacaatgccacc
atgcgctgggtcaacactcaggtcaaggagccggtgaagaatttcacgaccgactggaac
gatggacgcgtgctgtgcgaggtcatcaagggattgggcgggtcggcgccagcgccagat
aagctgagcaccgatcccttccactttgagaacaatatacgcaaggcggtcgatgcgggc
gccaagctgggcgtgcagcccatattgacgcccaaggacatggccaatccggaagtggag
catctgggcatcatggcgtatgcagcccatctgcagtgggtgccgccccggccgccgctc
tccgacctggtcaacgtatacttggagagcacatccggccgtgtgggcgaaccgacgcat
ttccggatcgacgtgctgtcgcgggacgtcagcctgagctcggtccgttgtcacgtggtg
ccgccatccgggcagcccggccagtcggtgcgcttgaatgtgcacggcgagggcgtctac
gtgccggagcgctacggcatgcacgagattgtcgtcgagattggcgaggacagcctgggt
ggccatttcttccgggtgctgccacgactcctgcaggtggcgccgcccggcatggcgccc
tgcgccctgggcagcctggtcgaggtgctggtgaatgcgacgggcgcacccaagacggag
gacattttggtcacggccgtctcacctacgggcatctcgcacaactgtccgctgaagaag
atcgacgagggacacagtgccatattcaagccggatgaggcgggcatctgggagatagcg
atcacctaccagggccgtcacatccagggcggacccttcacctgtgccgtcttcgatgcc
tccggcgtctcggtgcacggcctggacggtgccatgccgctgcgcgctcacacctttgag
gtggatgcccgtggcgtgggcgtcaacggggagctgcacgtggacattgtccatgacaag
cattcactggtctgctccctggagaagatcgtggacaacaagtaccgggtgaccttcatg
ccgcgccagaatggcaaatatcgcgtctacatctacttcaatggctacgacgtcaagggc
tcgcccttcatcatgcgcgtgggcacgaaaggtcgctcgggcaagacgcgcagcagcccg
ctgcacgagagcaaacaccgctcggagagcccctcgatgcacttcatctccacgacgaac
acacgccacaacgattatcgcaacagctcgctcaatcgccgggatctgcacacgcacaac
acggcggagcgcaccagcagctactcgccccaatattcgccgaagctggacacgaccgac
tatcacagctccagctccaggtactacaagcgggagagcgaggagaacaatggcccgtcc
cccacaccgaactcacccacagtcaaatacctgaactcagccgatctgtatacggaaacg
ggcggcgctcgtcgcgactcgaaggcgtccaacagcagctccacgaagaacgactactac
tacgacaaggagaacgagctctatagccagcggcgcattgtgagcaagccgaagctgacg
ccgccgcgcgaggagcgagagcagctgaacggcatcggcatcagcagcagcagcaacagc
tatcagcggcatcagcagcagcagcagctgactagctcgctcagtccaatacccagtccc
acactgaatacccgttcaagcgaggtgcactcgcacagtccgctgaccatcaagacatcg
aatcagtttgagagctcgacgcgcaacatcaccagcagtccgcgccacgcgtccgcctcg
ccggtgcagcgctattcgcccaacaatgcgtacatcagcaccgccacacatcgcattggc
agccccgtgaccagcaccctgaacaagaacggctacgagtccacacgtgtggagaagtcg
tccacttacaagtccacttcaaactatgtcaccgactcgagcgtgcgtgccagcccctcg
ttgtatgggacggcggagcgactgcgtcgcactggctcccccgagccgcgcatcgatcac
tcctccaatgtgcgcgtctcgtcgatgaagccggcctcagctcgccgcgatagctgggat
gtgatcaacaagacgaagcatatgctctcgcacaattcgctcgaatcgctggcgaatatg
accgagacgcagctaaacacggagctcaactacacacggccggacctggacaatgagacg
cagcgcaatacacagtacaacaaatttgcgctgcacaaacagcagcagcagcagcagcag
caccatcaaacggactatcgacgggattcacctgacgatgtggatcgctacaaaccgagt
gccatcactgtcaagtcccattcgaataatacctataccgataaatcgggcggctatacg
aagaccgtgaaggagtccagcgagcatatcgtcacggagagcaacggtcacagcttgaca
agtgctcccggctatggctacagttcgctgtcgcgctttcgtcccatagacagcaatgcg
accggtgctcgagccatacgtgtacaggacatacccaacggttcgattggacgacctgtg
gaattcgaaatcgacggctccaaggctggctctggcaatctggagatattggtcaatggc
ggtcgggtcacctcatcggtgcgttcgctgggagggcagcgtttcattgccagctttacg
cctcacgagcatggaacgcacaccgtgcagatcaccttcaacggagaaacggtaccaggt
tcaccgtggcacgctgagatcatgtcgtcacccggcctaaccgctctgggcgaatccacg
cgccttgtgcccgccaatacgccggcggtttttgagatactgccgcctcctggacaaagc
ctgagcaagggcgagtgcgtggcaacggtcttgaccccaaacaagtcaaagctgaatgcc
agagtcacccatgaggcggcaaatggtgctgcacgcattgagttcgtgcccaccgaggtg
ggcacgcacatcattgatgcgtccatcaatggcacgaagatcgctggcggccctttgata
gcaaaggtctacgatgccagcctgatccaagtgaccgaagtgaacggcggcgtggtcggc
cagccatgccagttccgtgtggacgcgagtgcggctggtgagggacagctggagatatcc
atcaatgagggcgaggtgcccaatcatgtccaggtcgttggaggcggccgttgtctcgtc
tccttcacgcccgaacaggccaaatcccatctgatcgacatcaagttcaacggcgagacg
gtgcgtggctgccccttcgtctgcgccgtggcggacacctcgcgcgtcctgctcaatctg
tccaatctggaactgatacccgtcaaccggccctcctcctttcacatcacagtgagcggc
ggcggtgccgccgagctggccgtcagcgttcgtggcccgcacggagagctgcccgttcgt
gtcaccggcgatattcacgccggcttcacggccgagttcacgcccaccagcgtgggcggg
cattccatcaatgtggagtacaatggctttgccgtgcagggcacaccgttcctggccaag
tcatatgacgccagcaaagtggtcgttggtagcgtctcgcgtggcaccatgggccgaccc
gtgcagttcacggtggatgccggcgatgctggcgagggcaatctggagataaccatatcg
gccaagggtcagaatatacccacacaggtgcatccgcagggcagtgcaagattctccgtt
tcgtttgtgccgacagagtcgtgcgagcacacaattaatgtctcctttaataaaatgcct
gtgcccggctgccccataaccgttggcattagcggcggcgtagccgggcctcaggtgtcc
cttggcggacccggacccgtccatcagaccaattcttttgttatcaatcacaatggcggc
cgtttggaagacattgaggtcaacgtcgaaggacggcgaaaacttttgtactag

DBGET integrated database retrieval system