KEGG   Drosophila mojavensis: Dmoj_GI19230Help
Entry
Dmoj_GI19230      CDS       T01062                                 

Definition
GI19230 gene product from transcript GI19230-RA
Orthology
K04437  
filamin
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1016 aa AA seqDB search
MGECLKQAAVKMDNTFELEGFEGIEPQIFVTSPAGDNEHCQLSQHDGGSYSASFRPSTVG
RHLISVLANDQHINGSPFSCNVFDVSRVSISGLEQQYGPATLGVPVTFSVDAAGAGEGTL
ELVVSTDSSTVKAEVVACARGLYDVTFVPQSTEPHYVNITFNEVAVDGSPFRVDIQQHTQ
HIQIGSLAAIDFPADDQIVEILAPDQKPVPYTINRQTAEFRTHSTGNYTLRFIDRETRQH
IGTRTLCAFDPMLVKITEVGEAICHRPASISVSLNEAGQGDLSALVRCGVTEVPHTIRGP
SKSGVYEIVYQPTRVAPHKISILFNDVPISLKPLEINVLPASAGKEISVSGLGLYQARVG
KTTSFAIDTVKRPAREFDVVVSGPGGQALPVRCYQTKNGHLQAEFSINKPGQCVIEVLHQ
SKPLPGSPFTCEAFDSSKVSVQGVSKEPLALHTANSFTVRTDSAGTAELEAFAISPTNQS
LPVHITEQSEGIYNVEFVPSQPGNYKLTLMYGGETIPSSPLTFSASSSGVRNDARAAGHG
LEVCHRNKEASFVVYCPIAPNVQIERIDEFGERIEPKIKALGNNEWRISYVILSVGTYEI
RASCPNRGSLPGSPWRVCCVESTKVTPVGGWGTLVDHDGRLILPARIIFDVENAGPGKLV
CSIDGIEIPVDKLADGKMCLNITGDNLAAGEHDLDLTWSGLTITQCPRSAFVTGQQAADK
VVLMGRGLAAAQAGEAAHFTIDASNAPAGRPEVILITQDNTALPVSLAQPRPSENIWLAS
YTPQKSMTGTLTLSVKWNGRLVKGCPLTVAVGSSMDASKVIASGEGLRHGIVGKDIKSWI
DTRRAGPGELTAHCAGPRKVAYCELYDHGDATFTLNIKPQEPGRHLLTIKYGGQNVPGSP
FALKVAGAPDASKVRVYGPGIEHGVLATFQSRFICDTRGAGAGQLTVRVRGPKGAFRVEM
QRESQKDRTILCKYDPTEPGDYRVEVKWAGEFVPGSPFPVMIFDTEEELRRYLQGI
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagtgcctgaagcaggcggccgtcaagatggacaacacatttgagctggagggc
ttcgagggcatcgagccacagatatttgtcacctcgcccgccggcgacaacgagcactgc
cagctgagccagcacgacggcggcagctacagcgcctccttccggcccagcaccgtgggc
cgccatctgatcagtgtgctggccaacgatcagcatatcaatggatcgccattcagctgc
aatgtgtttgacgtctcgcgcgtgagcatcagcggcctggagcagcaatatggcccggcc
acactgggcgtgccagttaccttcagtgtggatgcagcaggagccggcgagggcaccctg
gagctggtcgtctccacggacagcagcaccgtcaaagccgaggtggtggcctgcgcccgt
ggcctctacgatgtcacctttgtgccgcagagcaccgagccgcattacgtcaacatcacc
ttcaacgaggtggccgtcgacggcagccccttccgtgtggacatacagcagcacacacag
cacatacagatcggcagcttggccgccatcgattttccagccgatgaccagatcgtggag
atactggcgcccgaccagaagcccgtgccctacaccatcaatcgtcagacggcggagttc
cggacccactcgacgggcaactacacgctgaggttcatcgatcgcgagacccgacagcac
atcggcacacgcaccttgtgcgccttcgatccgatgctggtgaagatcaccgaggtgggc
gaggccatctgccatcgtccggccagcatcagcgtctccctcaacgaggctgggcagggt
gacctgtccgccctggtgcgctgtggcgtcaccgaggtgccgcacaccatacgcggtccg
agcaagtcgggcgtctacgagatcgtctatcagccgacgcgtgtcgctccgcacaagatt
agcattctgttcaacgatgtgcccatttcgctgaagcccctggagattaacgtgctgccc
gccagcgccggcaaggagatcagcgtcagtggcctaggcctgtatcaggcacgcgtgggc
aagaccacatcgtttgccatcgacaccgtgaagcggccggcacgcgaattcgatgtggtt
gtctccgggcccggcggccaggcgctgcccgtgcgctgctaccagacgaagaacggacac
ctgcaggcagagttcagcatcaacaagccgggtcaatgcgtcatagaggtgctccatcaa
tccaaaccgctgccgggcagcccattcacctgcgaggccttcgacagcagcaaggtgagc
gtgcagggcgtcagcaaggagccgctggcactgcataccgccaacagcttcaccgtgcgc
accgacagcgccggcacagccgagctggaagcctttgccatctcgcccaccaaccagagc
ctgcccgtgcacattaccgagcaatccgagggcatctacaatgtcgaatttgtgccctcc
cagccaggcaactataagctaactctaatgtacggcggcgaaacgattcccagctccccg
ctcacctttagcgcctcctccagtggcgtgcgcaatgatgcacgcgctgctggccacggc
ctggaggtgtgccatcgcaacaaggaggcctccttcgtggtctactgccccattgcgccc
aatgtgcagatcgagcgcatcgacgagtttggcgagcgcatcgagcccaagatcaaggcg
ctgggcaacaacgaatggcgcatctcctatgtcatcctgtccgtgggcacctacgagatc
cgcgccagctgccccaatcgcggcagtctgcccggctcgccgtggcgcgtctgctgtgtg
gagtcgacaaaggtaacgcccgtcggtggctggggcacgctggtggatcacgacggacgc
ttgatactgccggcccgcatcatcttcgatgtggagaatgcgggacccggcaagctggtc
tgcagcatcgatggcatcgagatacccgtggacaagctggccgatggcaagatgtgtctc
aacatcaccggcgacaacttggccgccggtgagcatgacttggacctgacctggtctggc
ctgaccatcacgcagtgcccgcgcagcgcctttgtcaccggccaacaggccgctgacaag
gtggtcctgatgggtcgtggcctggctgccgcccaagctggcgaggctgctcacttcacc
atcgatgcatcgaatgcgccagccggtcgaccggaggttatattgatcacccaagataat
acggcactgcccgtcagtctggcccagccgcgacccagcgaaaatatctggctagcctcg
tatacgccgcagaagtccatgacgggcacgctgacgctctcggtaaagtggaacggacgc
ctggtcaagggctgtccgctgaccgtggccgttggctcgtcgatggacgcctccaaggtg
attgcatctggcgagggtctgcgccacggcatcgttggcaaagacatcaagtcctggata
gacacgcgacgcgctggcccaggtgagctgaccgcccactgcgccggcccacgcaaggtg
gcctactgtgagctgtacgatcatggcgatgccacctttacgctgaacatcaagccacaa
gagccgggtcgccatctgctgaccatcaaatacggcggacagaatgtgccgggctctccc
tttgcgcttaaagtggctggcgctcccgatgccagcaaggtacgcgtctatggacctggc
attgagcacggcgttctggccaccttccagtcacgcttcatatgcgacacacgcggcgca
ggcgctggccagctgacggtgcgcgtgcgcggacccaagggcgccttccgcgtggaaatg
cagcgcgagagccaaaaggatcgcaccattttatgcaagtacgatccaacggaaccgggt
gactatcgtgtcgaggtgaaatgggccggcgaatttgtgcccggctcgccgttccccgtc
atgatcttcgacactgaggaggagttacgaaggtacttacagggcatatga

DBGET integrated database retrieval system