KEGG   Drosophila mojavensis: Dmoj_GI19537Help
Entry
Dmoj_GI19537      CDS       T01062                                 

Gene name
Dmoj_ST6Gal
Definition
Sialyltransferase
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
dmo  Drosophila mojavensis
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Dmoj_GI19537 (Dmoj_ST6Gal)
   00514 Other types of O-glycan biosynthesis
    Dmoj_GI19537 (Dmoj_ST6Gal)
Enzymes [BR:dmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     Dmoj_GI19537 (Dmoj_ST6Gal)
Glycosyltransferases [BR:dmo01003]
 Terminal extension
  Sialyltransferase
   Dmoj_GI19537 (Dmoj_ST6Gal)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 458 aa AA seqDB search
MLHVWSKEEERATLISGLLLAALIIQLAAAATPASASTSRAYKAQRVHEPIEEAAYATVV
SKALVKTRSAAMQRLPRSVFHVRWNPNEKFIVESRESPAINSSKLAPHPRLKVSKSTKLT
LSPKLYLCHDKYSSECHNKTASFRRRIVQSFERSMSESLNDSNHYNVDYKPVFGDSFEEQ
YYPSSCLVMEAGVRVLRRKDPPFNKLPFGRLFPRQKLFRNVKNIKTCAIVSSAGSLAGSK
LGRFIDSHDIVMRFNNAPTRGHEADVGSKTTIRVVNSQVVTKPEFDFAHAPIFRNVTIAA
WDPGRYNGTLEDWLTSADYDLFTNYEIYRRRYPKSRAFLIDPHSVWRLWQSLQMFAGNRA
IRRNPPSSGFIGLALLLPHCPQVDFIEYVPSTRLNGRCHYYSKEMNSGCTFGSWHPLAAE
KLMALDMNVADDMSVFQFGILRIRRPDKLLCGFNFFGY
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgttgcatgtgtggagcaaagaagaagaacgtgccacgctaatcagtggcctgctgctt
gctgcattaataattcaattggcagcggcagcgacaccggcgtcggcgtcgacgtcgcga
gcgtacaaagctcagcgagtgcacgaaccaattgaagaggcagcgtatgctacagtggtg
agcaaggcattagtcaagacgcgcagtgccgcaatgcagcgcctgccgcgcagcgttttt
catgtgcgctggaatcccaatgagaaattcattgtggagagtcgcgagagtccggccatc
aactcgtccaagctggcgccgcacccacgcctgaaggtgtccaagagcacgaaactcacg
ctcagccccaagctctatctgtgccacgacaagtactcgagcgagtgccacaataagacg
gcgtccttccggcgtcgcattgtgcagagctttgagcgctcgatgagcgaatcgctgaat
gattcgaatcactacaatgtggactacaagcccgtctttggcgacagcttcgaggagcag
tattatccctcgagctgcctggtcatggaggcgggcgtgcgtgtgctacggcgcaaggat
ccgccgttcaacaagctgcccttcggccgactctttccgcgccagaaactcttccgcaat
gtgaagaacatcaagacctgtgcgattgtctccagcgccgggtcgctggcgggctccaag
ctgggccggtttatagatagccacgatattgtcatgcgcttcaataacgcgcccacccgc
ggccacgaggcggacgtgggcagcaagacgacaattcgcgtggtcaattcacaagtggtc
accaagccggagtttgatttcgctcatgcgccaatcttccggaacgtcacgatcgccgcc
tgggatcccggccgttacaatggcaccctcgaggattggctaaccagcgccgactacgat
ctgttcaccaactacgagatctacagacgtcgctaccccaagtcgcgcgcctttctcatc
gatccgcactccgtgtggcgactctggcagagcctgcaaatgtttgccggcaatcgagcc
atacgtcgtaatcctcccagttccggtttcataggcttggctttgttacttccgcactgc
ccccaggtggactttatagagtatgtgccctcgacgcgactcaatggccgctgtcactac
tacagcaaagagatgaattccggctgcacgtttggctcgtggcatccgttggctgccgag
aagctgatggccttggatatgaatgtggccgacgatatgtccgtcttccagtttggcatc
ttgcgcatccgccggccggataagctgctctgcggcttcaatttctttggttactga

DBGET integrated database retrieval system