KEGG   Drosophila mojavensis: Dmoj_GI19593Help
Entry
Dmoj_GI19593      CDS       T01062                                 

Definition
GI19593 gene product from transcript GI19593-RA
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dmo  Drosophila mojavensis
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dmo04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 488 aa AA seqDB search
MWRLLAVLACSFIAIVAGAEQDVLELGDDNFASTLKQHETTLVMFYAPWCGHCKRLKPEY
AKAAEIIKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREANG
IAKYMRAQVGPASKQVRSIEELAKFLDTKDTTIFGYFKDIDSKLAKTFLKFADKNREKYR
FGHSEDEEVLKQQGETDKIVLIRAPHLANKFESSTIKFEGSSESDLITFVKENYHGLVGH
RTQDTARDFQNPLITAYYAVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAISSKDDFQHE
LNEYGYDFVGDKPVILARDAKNLKYALKEEFSVENLQDFVEKLLANELEPYIKSEPVPES
NDAPVKVAVAKNFDEVVINNGKDTLVEFYAPWCGHCKKLTPIYEELAEKLQNEDVAIVKM
DATANDVPPEFNVRGFPTLFWLPKDSKNKPVSYNGGRELDDFIKYIAKEATTELKSFDRS
GKPKKTEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcttattagctgttctcgcatgcagctttattgcaatagttgctggtgctgag
caagatgtgctggaacttggcgatgacaatttcgcctccactttgaagcagcatgagacc
acattggttatgttctacgcaccctggtgcggccactgcaagcgtttgaagcccgaatat
gccaaagctgctgagattattaaagatgacgatccaccaatcaaattggccaaggtcgac
tgcacagaagccggcaaggagacgtgcagcaagtactcagtgagtggctatccaacgctg
aagatcttccgccaggacgaggtgtcgcaggactacaacggaccacgcgaggctaatggc
attgccaagtatatgcgtgctcaggttggacctgcatctaagcaggtgcgcagcattgag
gagctagccaaattcctggacactaaggatacaactatctttggctatttcaaagacatt
gactccaaattggcaaagactttcctgaagtttgctgacaagaatcgtgagaaataccgt
tttggacacagcgaagacgaggaagtgcttaagcagcaaggcgaaacagataagattgtg
ctgatacgcgcaccacacttggccaacaaatttgagtcgtccacaattaagtttgaaggt
agctccgagtctgatttgatcactttcgtcaaggagaactaccatggtttggtgggccac
cgcacacaggacactgctcgcgacttccagaatcctttgattactgcttactatgctgtt
gattaccagaagaaccccaagggcacgaactactggcgaaaccgtgttttgaaggtggcc
aaggagtttgttggccagattaactttgccatcagctcgaaggatgatttccagcatgag
ttgaatgaatatggctacgatttcgttggtgacaagcccgtcattttggcacgcgatgcc
aagaatctcaaatatgccctgaaggaggaattctccgtggagaatctgcaagactttgtg
gagaagttgctggccaacgaactggaaccctacatcaagagcgagccagtgcccgagtcg
aatgatgcacctgttaaggtggccgtcgccaagaacttcgatgaagtagtcatcaacaat
ggcaaggatacgctggtcgagttctatgccccctggtgcggacactgcaagaaactgact
cccatctacgaggagctggccgagaaactgcaaaatgaagatgtagccattgtcaaaatg
gatgccacggccaacgatgtgcctccagagttcaatgtgcgcggtttccccacactcttc
tggctgcccaaggactcgaagaacaagcccgtcagctacaatggaggtcgcgaactggac
gacttcatcaaatacattgccaaggaggccaccacagaactgaagagcttcgatcgcagt
ggcaagcccaagaagactgagctgtag

DBGET integrated database retrieval system