KEGG   Drosophila mojavensis: Dmoj_GI19593Help
Entry
Dmoj_GI19593      CDS       T01062                                 

Definition
GI19593 gene product from transcript GI19593-RA
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dmo  Drosophila mojavensis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmoj_GI19593
Enzymes [BR:dmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dmoj_GI19593
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dmoj_GI19593
  Exosomal proteins of colorectal cancer cells
   Dmoj_GI19593
  Exosomal proteins of bladder cancer cells
   Dmoj_GI19593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 488 aa AA seqDB search
MWRLLAVLACSFIAIVAGAEQDVLELGDDNFASTLKQHETTLVMFYAPWCGHCKRLKPEY
AKAAEIIKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREANG
IAKYMRAQVGPASKQVRSIEELAKFLDTKDTTIFGYFKDIDSKLAKTFLKFADKNREKYR
FGHSEDEEVLKQQGETDKIVLIRAPHLANKFESSTIKFEGSSESDLITFVKENYHGLVGH
RTQDTARDFQNPLITAYYAVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAISSKDDFQHE
LNEYGYDFVGDKPVILARDAKNLKYALKEEFSVENLQDFVEKLLANELEPYIKSEPVPES
NDAPVKVAVAKNFDEVVINNGKDTLVEFYAPWCGHCKKLTPIYEELAEKLQNEDVAIVKM
DATANDVPPEFNVRGFPTLFWLPKDSKNKPVSYNGGRELDDFIKYIAKEATTELKSFDRS
GKPKKTEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcttattagctgttctcgcatgcagctttattgcaatagttgctggtgctgag
caagatgtgctggaacttggcgatgacaatttcgcctccactttgaagcagcatgagacc
acattggttatgttctacgcaccctggtgcggccactgcaagcgtttgaagcccgaatat
gccaaagctgctgagattattaaagatgacgatccaccaatcaaattggccaaggtcgac
tgcacagaagccggcaaggagacgtgcagcaagtactcagtgagtggctatccaacgctg
aagatcttccgccaggacgaggtgtcgcaggactacaacggaccacgcgaggctaatggc
attgccaagtatatgcgtgctcaggttggacctgcatctaagcaggtgcgcagcattgag
gagctagccaaattcctggacactaaggatacaactatctttggctatttcaaagacatt
gactccaaattggcaaagactttcctgaagtttgctgacaagaatcgtgagaaataccgt
tttggacacagcgaagacgaggaagtgcttaagcagcaaggcgaaacagataagattgtg
ctgatacgcgcaccacacttggccaacaaatttgagtcgtccacaattaagtttgaaggt
agctccgagtctgatttgatcactttcgtcaaggagaactaccatggtttggtgggccac
cgcacacaggacactgctcgcgacttccagaatcctttgattactgcttactatgctgtt
gattaccagaagaaccccaagggcacgaactactggcgaaaccgtgttttgaaggtggcc
aaggagtttgttggccagattaactttgccatcagctcgaaggatgatttccagcatgag
ttgaatgaatatggctacgatttcgttggtgacaagcccgtcattttggcacgcgatgcc
aagaatctcaaatatgccctgaaggaggaattctccgtggagaatctgcaagactttgtg
gagaagttgctggccaacgaactggaaccctacatcaagagcgagccagtgcccgagtcg
aatgatgcacctgttaaggtggccgtcgccaagaacttcgatgaagtagtcatcaacaat
ggcaaggatacgctggtcgagttctatgccccctggtgcggacactgcaagaaactgact
cccatctacgaggagctggccgagaaactgcaaaatgaagatgtagccattgtcaaaatg
gatgccacggccaacgatgtgcctccagagttcaatgtgcgcggtttccccacactcttc
tggctgcccaaggactcgaagaacaagcccgtcagctacaatggaggtcgcgaactggac
gacttcatcaaatacattgccaaggaggccaccacagaactgaagagcttcgatcgcagt
ggcaagcccaagaagactgagctgtag

DBGET integrated database retrieval system