KEGG   Drosophila mojavensis: Dmoj_GI19628Help
Entry
Dmoj_GI19628      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01189  alpha-galactosidase [EC:3.2.1.22]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00052  Galactose metabolism
dmo00561  Glycerolipid metabolism
dmo00600  Sphingolipid metabolism
dmo00603  Glycosphingolipid biosynthesis - globo and isoglobo series
dmo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dmoj_GI19628
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dmoj_GI19628
   00600 Sphingolipid metabolism
    Dmoj_GI19628
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    Dmoj_GI19628
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dmoj_GI19628
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dmoj_GI19628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase
Motif
Other DBs
NCBI-GeneID: 6578506
NCBI-ProteinID: XP_002004416
FlyBase: FBgn0142365
UniProt: B4KRT1
Position
Unknown
AA seq 417 aa AA seqDB search
MFGMRNVPLLLLLLMQLLRAGSALDNGLALTPPMGWMSWQRFRCITDCDTYPDECISEQL
FRRSADLLVSEGYADVGYEYVIIDDCWLEWNRDNMTNKLVPDRKRFPRGLNVLADHIHNK
GLKFGLYQDFGTKTCAGYPGVIDHMALDAETFAKWDVDYVKLDGCNANVSDMAAGYPEFG
RLLNETGRPMVYSCSWPAYQSEFGEQPHFESLKRHCNLWRNWDDIDDSFESVMEIVDYFA
KNQDSMQPHAGPGHWNDPDMLILGNYGLSYDQSKVQMAIWAVLAAPLIMSNDLAKVRPEI
KEILQNRDVIAVNQDPLGIQGKRLLMKQNIEVWRRPIEPKINGEYSYAIAFVSRRVDGSP
FPISFTFKELSLFNDNIGYIVQDLFDKNNNLGVFRNESQFKTRVIPNGVNFYKFTAL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcatgaggaacgttccattgctgctgctgctgttgatgcagttgctccgcgct
ggctctgcattggataatggactggctttaacgccacccatgggttggatgtcttggcag
cgctttcgatgcatcaccgattgtgatacgtatccagatgagtgcataagcgagcaattg
ttcagacgcagtgccgatctacttgtgtcggaaggctatgctgatgtgggctatgaatat
gttatcatagacgattgctggctggagtggaatcgggataacatgacaaacaagcttgta
ccagatcggaaacgttttcccagaggcctcaacgttctggctgatcatatacacaataaa
ggactcaagtttggactgtatcaggactttggcacaaagacctgtgctgggtacccaggt
gtgatcgaccacatggcactcgatgccgaaacctttgctaagtgggatgtggactatgtg
aagctggatggctgcaatgcgaatgttagcgacatggcagcaggctatccagaattcgga
cgactgctgaatgaaacaggcagacccatggtctattcgtgcagctggcctgcctatcaa
tcggaatttggtgaacagcctcactttgagtcgttgaagcgccattgcaatctctggcga
aactgggatgacatcgacgattcatttgagtcagttatggaaatcgttgactactttgcc
aaaaatcaggatagcatgcagccacacgccggcccagggcattggaacgatccagatatg
ttgattttaggcaactatggccttagctatgatcagagcaaagtgcaaatggccatttgg
gctgtgctggcggcgcctttaataatgtccaatgacttggccaaggtgcgaccagaaatt
aaggagatattacagaatcgtgatgtgattgctgtcaatcaggatcctttgggcatacag
ggtaaacgattgcttatgaagcaaaatattgaggtctggcgtcgaccaatcgaacctaaa
atcaatggagaatactcttatgctatagcatttgttagtcgccgcgtggacggatctcct
tttcccatatcatttacgtttaaggagctctcgctattcaatgataatattggctacatc
gtgcaggatttgtttgataagaataacaatttgggcgtctttcgtaacgagagtcaattc
aaaacacgcgttattcctaacggcgtcaacttctacaaatttacggcgctttga

DBGET integrated database retrieval system