KEGG   Drosophila mojavensis: Dmoj_GI19758Help
Entry
Dmoj_GI19758      CDS       T01062                                 

Definition
GI19758 gene product from transcript GI19758-RA
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dmo  Drosophila mojavensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dmo00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 297 aa AA seqDB search
MATTAAAVAATSVVVLDRGNNTTCTINLHGATVVSWRVNNQEQLFVSKLASFDGKKAIRG
GIPFVFPQFGPWSFGPQHGFARITRWHLDRAPERLHNGDVEAIFSLLDNEFTRSIWNYQF
RITYRLILREKELHFHIGVYNPSKDLSFTFNMLLHTYLKVPDVRRCQITGLQGCHFIDKT
REGALYQEGREVVTVNEWTDRIYQHTPQEHVITNVVSGRKMRLHKYNFPDTVIWNPWIDR
SREMSDFGDDEFPNMLCVEAGNVSSPVILLPGTCFEASQILQIIIEGNVSRKTKRNR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggccacgactgcggctgccgtagcagccaccagtgttgttgtattggatcgtggcaat
aatacgacatgcacaatcaacttgcatggtgcgactgttgtgtcttggcgtgttaataat
caggagcagttgtttgttagcaagttggcatcgtttgatggtaaaaaggctatacgtgga
ggtataccgtttgtttttccacaatttggaccctggtcctttggtccacagcacggcttt
gcaagaatcacacgctggcatttggatcgagccccagaacgactgcacaatggcgatgtg
gaggcaatattttcgctgttggacaatgagtttacgcgttctatatggaactatcaattt
cggataacctatcgcttgattctgcgtgaaaaggaactacactttcacatcggcgtttat
aatcctagcaaagatctgagtttcacattcaacatgttgttgcacacctatctaaaagtt
ccagatgttcgacgatgtcagataactggacttcagggctgccactttatagacaagaca
cgcgagggcgctctgtatcaggagggtcgtgaggtggtcactgttaacgagtggacagat
cgcatctatcagcatacgccacaggagcatgtaataacgaatgtagtatctgggcgtaag
atgaggctgcacaaatataatttcccagatacagttatttggaatccgtggatcgatcgg
tcgcgagaaatgagcgactttggtgacgatgagtttcccaatatgctatgcgtagaggct
ggcaatgtcagctccccagtcatattgcttccgggcacttgctttgaagccagccagata
ctacagattatcatcgaaggaaatgtcagccgtaagaccaaacggaatcgctag

DBGET integrated database retrieval system