KEGG   Drosophila mojavensis: Dmoj_GI19764Help
Entry
Dmoj_GI19764      CDS       T01062                                 

Definition
GI19764 gene product from transcript GI19764-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dmo  Drosophila mojavensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dmoj_GI19764
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dmoj_GI19764
   00603 Glycosphingolipid biosynthesis - globo series
    Dmoj_GI19764
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dmoj_GI19764
   00511 Other glycan degradation
    Dmoj_GI19764
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dmoj_GI19764
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dmoj_GI19764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 664 aa AA seqDB search
MSLAVSLRRALLLLLSGAIFILTVLYWNQGVIKTQSYNEAQLRPHLQKDRSSAPIPLEKS
WTYKCDNDRCVRVNYNKNGANVKRVSFISCSMTCGDINIWPHPTSKSLVSGHTLRFSVED
VQLRLDTPHREVRKRLKLAFDVLVRQLRQIQQLEYAAPRAEEISSVSEPASKSTDGAASP
LASGLFSSTFGSHRSGDLDSLHVKLSVHESGELDFNLDNDESYELATSFEHRRLTVHIRA
KSFFGARHGLATLQQLIWYDDEERLLCTYASSLINDAPKFRYRGLMLDTSRHFFSVDAIK
RTISAMGLAKLNRFHWHITDAQSFPYISRHYPELAEHGAYSDSETYSEQDVREVTEYAKI
FGVQVLLEIDAPAHAGNGWDWGPKRGLGELSLCINQQPWSFYCGEPPCGQLNPKNNHTYL
ILQRLYEEFLQLTGPTDIFHLGGDEVNLDCWAQYFNDTDLRGLWCDFMLQSNARLKVANG
NVAPKHVVVWSSALTNTKCLPNSQFVVQVWGGSTWQENYDLLDNGYNIIFSHVDAWYLDC
GFGSWRATGDAACSPYRTWQNVYKHRPWERMRLDKKRRKQVLGGEACLWTEQVDEGQLDN
RLWPRVAALAERLWSDPNDDHDFDVVPPEVFRRISVFRNRLVELGIKAEALFPKYCAQNP
GECI
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcactggccgtctccctacgccgtgccttgctgctgttactctcaggagccattttc
attctgacagtgctgtactggaatcagggcgtgattaagacacagtcctacaatgaagca
cagctgcgtccacacctccagaaggatcgcagttcggctcccataccgctggaaaagtca
tggacctataaatgcgacaatgacagatgtgtacgcgttaattataacaagaacggagcc
aacgtgaagcgtgtctccttcatcagctgttcaatgacctgtggagatattaacatttgg
cctcatcccacctccaagtcgctggtcagcggtcacacgctccgcttctccgtggaggat
gtacagttgcggctggatacgccgcatcgcgaagtacgcaagcgcctcaagttggccttt
gatgtgcttgtcaggcaattgcggcaaatacagcagctggagtacgcagcgccgcgtgca
gaggaaatatcatctgtcagcgagccagcttcgaaatctacagacggtgctgcatcgccg
ctagctagcggactttttagctccacttttggctcacaccggtctggcgatctggatagc
ctgcatgtgaagctctcggtgcatgagtcaggcgagctcgactttaatcttgacaacgat
gagagctatgagctagcaacaagctttgagcatcggcgtttgactgtgcacatcagggcc
aagtcattctttggcgcacgtcacggactggccacgctgcagcagctaatttggtatgac
gatgaggagcgattgctgtgcacctatgccagctccttgatcaatgatgcgcccaagttt
cgatatcgcggccttatgctggacacctctaggcacttcttttccgtggatgccattaaa
cgcaccatttcggcaatgggcttggcgaagctgaatcgctttcattggcacataacggat
gctcagagctttccatatatttcacgacattatccggagctggctgagcacggcgcctac
tcggacagtgaaacatacagcgagcaggacgtgcgtgaggtcaccgagtatgccaaaatt
tttggcgtgcaggtgctcctggaaatcgatgcacctgcgcatgcgggcaacggctgggac
tggggacccaagcggggccttggcgaattgtcgctatgcattaatcagcagccatggagc
ttttattgcggtgaaccaccgtgcggtcaactaaacccgaagaataaccacacctacctc
atactacagcgcctgtacgaagagtttctgcagctaacggggcccacggacatctttcac
ctgggcggcgatgaggtgaatctcgattgctgggcccagtatttcaatgatacggatcta
cgcggcctgtggtgcgacttcatgctacaatccaatgcgagactgaaagtggccaatgga
aatgttgcgcccaagcatgtggttgtctggtcgagtgcgctgacaaacaccaagtgtctt
ccaaacagtcaattcgtggttcaggtgtggggtggcagcacttggcaggagaactatgat
ctgctggacaatggatacaatattatattttcgcacgtggatgcttggtatttggattgc
ggcttcggcagctggcgagctactggcgatgccgcttgttcgccttatcgcacttggcaa
aacgtttataagcaccggccttgggagcgaatgcgtctggataagaagcgccgaaagcag
gtgctgggtggcgaggcttgcttatggaccgagcaagtggatgagggtcagctggataat
cgattgtggccgcgcgttgctgcccttgccgaacgtctgtggtcagatcctaatgatgat
catgacttcgatgttgtgcccccagaagtatttcgacgaatctcagtgtttagaaatcgt
cttgttgagttgggcatcaaagccgaggcgctgtttcccaagtactgcgcgcagaatccc
ggcgagtgcatttga

DBGET integrated database retrieval system