KEGG   Drosophila mojavensis: Dmoj_GI19875Help
Entry
Dmoj_GI19875      CDS       T01062                                 

Definition
GI19875 gene product from transcript GI19875-RA
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmoj_GI19875
Peptidases [BR:dmo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmoj_GI19875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 838 aa AA seqDB search
MAVKQNPQDQQEQEITAAEVAAAAAAAAAAASAANSAVGGGPANSTDEGGGGCGAGGVDV
ANELNGDADSKTESAAGTGKSSCSTERQLHDINGLLSIMQAINPDDQPATLMIYQHVIFN
LARMQLSTQPEDLKRFKEEITKVGQFLALPNKKRYLMFYLRIVYQLITQASYEPSCAVAI
VFQLFSPNLVIEAVQLLLDLNVQDDSIRKTVGLLCKWISSCNFCQNLNLWIMALLQGLRE
QEKYLLLDEIALDNIESLFILMIFPALRLKVAPIVFHMLSTINQSPEIFYKILPKIPLVI
GCMKGQDGTPNDLRSYIQKLVDLTNALMMRFYDNDELYAPIKAALQLYEPSPNCVALARA
LFENALPRNARVGLVNLGNTCYMNSVLQALAMTSDFVRQILLIESGSLLLLKVQQQLALM
HHSLRYELTPSRVLKATRPPGFTPGLQQDSSEFLGYLLDLLHEHEINSGAAQHMDPELGK
ETQESESTLTAEIVAAGVIPYNSNDHVHNQRSSAAVMPQATPTSQPSQPKKPSTIDKTFA
GKLSTTYKCLNCSWESRNEDSFRELQLSFPDDKDDCGATNYSVQDLIDYYCSPEKLDGDN
QYFCPRCKKLCDAERRIGITQAPRNLILTLKQFKYDQKYHFRTKLMHKVFHDESVIVKVC
ATDSLQETCTVHYDLYAGVVHAGYSMDSGHYFTFAADQSKNWFKFNDSLVTNSKPQEMHS
LTSPNTPYILFYQMCGRSTESSPDGPMHPMVPEPLVPPLTLDELPRTLRDYVKQDNREYS
EELKLQRFKRNAKRQNVAGNGTMQRNGYEGDDEDDHMPPPAGGCGGNDLGMNFNRFVY
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaagcagaacccacaggatcagcaggagcaagagatcaccgcagcagaagtt
gcagcggcagcggctgcagcagcagcagcggcgtcggcggcgaattcagctgtgggcggt
ggcccagcaaattcaacagatgaaggaggaggtggctgtggtgctggcggagtagacgtg
gccaatgaactgaacggtgatgcggacagcaagacagagtccgctgctggaacgggcaag
agctcgtgctccaccgaacggcaactgcacgatatcaatggcctgctcagcattatgcaa
gccatcaatccggatgatcagccggccacgctaatgatctaccagcacgtcatcttcaat
ctggcgcgcatgcagctgagcacccagccggaggatctgaaacgcttcaaggaggagatc
accaaggtgggccagttccttgcgctgcccaataagaagcgctacctcatgttctacttg
cgcattgtctatcagctaatcacccaagcctcctacgagccctcctgtgccgtggccatt
gtctttcagctgttcagcccgaacctggtcatcgaggcggtgcagctgctgctcgatctg
aatgtccaggatgacagcatacgcaagacggtcggtttgctctgcaagtggatcagctcc
tgcaacttttgccagaatctgaatttgtggatcatggccctgctgcaagggctgcgcgag
caggagaagtacttgctactggacgagatcgccctggacaacattgagtcgctgttcata
ctgatgatctttccggcactgcgcctcaaggtggcgcccatcgtttttcacatgctgtcc
acaatcaatcagtcgccggagatcttctacaagattctgcccaagattccccttgtcatt
ggctgcatgaagggccaggacggcacgcccaatgacctgcgcagctacatacagaagctg
gttgatctcaccaatgcgctgatgatgcgcttctacgacaacgacgagctctacgcgccc
atcaaggccgccctgcagctctacgagccctcgcccaattgtgtggccttagccagggcg
ctcttcgagaacgccttgccccggaatgcgcgcgttggactcgttaatctgggaaatact
tgttacatgaacagtgtgcttcaagcgctcgccatgaccagcgacttcgtgcgtcaaatc
ctgcttattgagagcggctccttgttgctgctgaaggtgcagcagcagttggcattgatg
caccactcgctgcgctacgagctgacgccgagtcgcgtcctgaaggccaccagaccgccg
ggctttacgcctggactgcagcaggacagctccgagttcctaggctacttgctcgatctg
ctgcatgagcatgagatcaacagtggcgcggctcagcacatggacccggagcttggcaag
gagacacaggaatcggagtcgacactgacagcggaaattgtcgccgccggggttataccc
tacaatagcaacgatcatgtgcacaatcagcgatccagtgcagcggttatgccacaggcc
acgcccacctcgcagcccagccagccgaagaaaccgtcgaccattgacaagaccttcgct
ggcaaattgtcgacgacctacaagtgcttgaactgctcctgggagagccgcaacgaggac
agcttccgtgagctgcagctctcctttccggacgacaaggacgactgcggtgctaccaat
tactccgtacaggatttgatcgactactactgctcgccggagaagctcgacggcgacaat
caatacttttgtccacgctgcaagaaactctgcgatgccgagcgacgcatcggcatcacg
caggccccacgcaatctcatcttaacgctcaaacaattcaaatacgatcagaagtatcat
tttcgcacaaagctcatgcacaaggtgttccacgacgagagcgtgattgttaaggtctgc
gccaccgactctctccaggagacgtgcaccgtgcactatgatctctatgccggagttgtg
cacgccggctacagcatggactccggacactacttcacctttgccgccgatcagtccaag
aattggttcaagttcaacgacagcctggtgaccaattcgaagccgcaggagatgcacagc
ctgacctcaccgaacacgccctacatcctcttctaccagatgtgcggccggtccacggag
tcctctcccgatggacccatgcatcccatggtgccggaaccgctcgtgccacccctcacg
cttgacgagctgccgcgaaccctgcgcgactacgtcaagcaggacaatcgggagtacagc
gaggagctgaagctgcagcgcttcaagcggaacgccaagcggcagaacgtggctggcaac
gggacgatgcagcgcaacggctatgaaggagatgacgaagatgatcacatgccgccgccc
gccggtggctgtggtggcaatgatctgggcatgaatttcaatcgtttcgtctactga

DBGET integrated database retrieval system