KEGG   Drosophila mojavensis: Dmoj_GI19888Help
Entry
Dmoj_GI19888      CDS       T01062                                 

Definition
GI19888 gene product from transcript GI19888-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dmo  Drosophila mojavensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dmo00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 524 aa AA seqDB search
MGQFYGLFRLLLVSFFVLTVAKAEKDRQHGRTLSRPTPAVRFEKETLSSYWREDAQKILA
DKLDALAQLKKQGAKNVILFLGDGMSIHTITATRNLLGDSSEKVYFEKFPYTGLSKTYCV
NRQVADSACTSTAYLGGVKGNYGTIGVNANVPRYDCNAAYVEQNQVDSIAKWAQDAGKDA
GIVTSARVTHASPAGAYAHISDRNWENDAEVRAQGCDPEVSIDIARQLVEWEVGKKLKVI
LGGGRQMFLNETVRDEVGHPGYRQDGRNLIKDWLADKQAQNASASYVWSRKGLTEVDLDN
TDYLLGLFANGHLPYDGDRERSPKNSHLADPSLTELTEAALKVLRKNEKGYFLFVEGARI
DMAHHSNYARRSLEDTAEFARAIQKAREMTDVEDTLIVVTSDHSHVMTINGYPLREQEIT
GLANSLADDERPYNILSYANGPGYAGTYTKADGRKPISQKHTENPMFVNPAMVPLSADTH
GGDDVAVFASGPFAQYFSGNYEQTNIPAMMARAAAIGPFANVQP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgggccagttttatggtttatttcgactgctgttggtcagcttttttgtgctgactgta
gccaaagcggaaaaggaccgtcagcatggacgaaccctgtcaaggcccacgccagccgtt
agatttgagaaggaaacgctaagcagctactggcgcgaggatgcgcagaagatactggcc
gacaagctggatgcactggctcagctgaagaagcaaggtgccaagaatgtgatcttgttt
ctgggcgatggcatgtcgattcatacgataactgcgaccaggaatctgctgggggacagc
tccgagaaggtgtactttgagaagtttccctacacgggtctatcgaagacctactgtgtg
aatcgccaggtcgctgactccgcctgcacctccacagcttatctgggcggtgtgaagggc
aactatggtacgattggtgtgaatgcgaacgtgccgcgttacgattgcaatgccgcctat
gtggagcagaatcaggtggatagcatcgccaagtgggcgcaggatgcgggcaaggatgcg
ggcattgtgacaagtgccagagtcacgcatgcctcaccagctggcgcctatgcgcacatc
tccgatcgcaactgggagaacgatgcagaggttagggctcaaggttgcgatccagaggtc
agcatagacatagctcgtcagctagtcgaatgggaggtgggcaagaaattgaaggtgatt
ctcggtggcggcagacagatgttcctgaacgagaccgtgcgtgatgaggtgggtcatccg
ggctatcgccaggacgggcgcaatttgatcaaggactggctagccgataagcaggcacag
aatgcctcggcgagctatgtgtggagccgcaaaggtctaaccgaagtggacttggataat
acggactatctgctgggtctctttgccaatggacatttgccatatgacggcgatcgtgag
cgcagccctaagaatagccatttagctgatccatcgctaaccgaactgacggaggccgct
ttgaaggttctacggaagaatgagaaaggatatttcctgtttgtggaaggcgcacgcatc
gacatggcccatcattcgaactatgcacgtcgctcgctggaggacaccgccgagttcgct
cgcgccatacagaaagcacgtgaaatgaccgacgtggaagataccctaattgtcgtgacg
tccgatcattcgcacgtgatgaccatcaatggttatccgctacgcgaacaggagataact
ggcttggctaatagcttagccgacgatgagagaccctataatatactctcctatgccaat
ggacccggctatgcgggcacatacactaaggcagacggtcgcaagcccattagccaaaag
cacaccgaaaatccgatgtttgtgaatccggcaatggtgccgctcagtgccgacacccat
ggtggggatgatgttgctgttttcgcttcgggtcctttcgcccagtattttagcggcaat
tacgagcagaccaatattcctgctatgatggccagagctgctgccatcggtccttttgcc
aatgtccagccttag

DBGET integrated database retrieval system