KEGG   Drosophila mojavensis: Dmoj_GI19918Help
Entry
Dmoj_GI19918      CDS       T01062                                 

Definition
GI19918 gene product from transcript GI19918-RA
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
dmo  Drosophila mojavensis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dmo00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dmo00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:dmo00471]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 727 aa AA seqDB search
MFKGVPTLANLNLRLLSSHTAKGRACPGRVVQCRSKATATSLDLNEANGNGQIDVDVYSE
QDLLKRDKFRHRGLDVQQKIASERKLRTPPLLNLVFANRKLSFYDTSTGQKPCEENAKLN
QRRNYSIRPHREQEQRNAEDVLFDMFASEETGLISMGKFLAGLKTTGIRRNDPRVRELMD
NLKKVHKLNNYETGSSAETQHLNRETFKAVVSPNIVLIAKAFRQQFVIPDFASFVKDIEE
IYHRCKSNTLGKLADYIPQLARYSPNFWGVSICTVDGQRFSIGDVEEPFTLQSCSKPLTY
AIALEKLGPKLVHSFVGQEPSGRIFNELVLDQNKKPHNPMINAGAILTCSLMSALVKPDM
TSAEIFDYTMSWFKRLSGGEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKE
VMDYYFQCCSMETNCEAMSVIAASLANGGICPTTEEKIFRPEVIRDVLSIMHSCGTYDYS
GQFAFKVGLPAKSGVSGGMMLVIPNVMGIFAWSPPLDQLGNTVRGLQFCEELVNTFNFHR
YDNLKHLSNKKDPRKHRYETKGLSIVNLLFSAASGDVTALRRHRLSGMDITLADYDGRTA
LHLAASEGHLECVKFLLEQCHVPHNPKDRWGNLPVDEAENFNHSDVVEYLKKWAENAKDA
PQQCMSDAVTTKTEADEELPCNPDDVVASGISSPIPTVSEPRSPSPVSSEDGSTVSGTSV
DKTKPGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaggtgtgccaacgcttgcgaatttgaatttgcgtttgctcagcagccacacg
gccaagggtcgtgcgtgtcctggccgagtggtgcagtgccgcagcaaggcaacggccaca
tccctcgacctcaacgaggccaatggcaatggccagatcgatgtcgatgtctacagcgag
caggacctactgaaacgagacaaattccggcatcggggactcgatgtgcagcagaaaatc
gcatctgagagaaaactacgtacgccgccgttgttgaatttggtttttgccaaccgtaaa
ttatccttctacgacaccagcaccggacagaagccctgcgaggagaatgccaaactaaat
cagcgacgcaactattcgataaggccccatcgcgagcaggagcagcgcaacgcggaggat
gtgctcttcgatatgtttgccagcgaggagacgggcctcatatccatgggcaagttcctg
gccggactgaagaccacgggcatacggcgcaatgatccgcgcgtgcgcgagctcatggac
aacctgaagaaggtgcacaagctgaacaactacgagacgggctcgtcggccgagactcag
catctcaaccgcgagaccttcaaggctgtggtctcgccgaacattgtgctgattgccaag
gcgttccgccaacagtttgtcatcccggacttcgcgagcttcgtcaaggacattgaggaa
atttaccatcgctgcaagtccaacactctcggcaagctggccgactacattccccagctg
gcgcgctacagccccaacttctggggcgtcagcatttgcacagtggacggacaacgcttc
tccattggcgatgtcgaggagcccttcacgctgcagagttgcagcaagccactgacctat
gccatcgccctagagaagctgggacccaagctggtgcactcgttcgtaggccaggagcca
agtggccgcatcttcaatgagctcgttctcgaccagaataagaaaccgcacaatccgatg
atcaatgcaggcgccatactcacctgctcgctgatgagcgccttggtcaagcccgacatg
acctccgcggagatctttgactacacgatgtcctggttcaagcgcctgtctggcggcgag
tacattggcttcaataatgccgtatttctctcagagcgcgaggcagccgatcgcaactac
gccctgggcttttatatgcgcgagaacaaatgcttcccgaagcgcacaaacctgaaggag
gtgatggactactacttccagtgctgctccatggagacaaactgcgaggcgatgtctgtg
atagccgccagcctggccaacggcggcatttgtcccaccaccgaggagaagatctttcgc
ccggaagtcatccgggatgtgctctccataatgcactcgtgcggcacctacgactactcg
ggacagttcgccttcaaggtcggcctgccagccaagtcgggcgtcagcggcggcatgatg
ctggtcattcccaatgtgatgggcatctttgcctggtcgccgcctctggaccagctgggc
aatacggtgcgcggcctgcagttctgcgaggagctggtcaacaccttcaacttccatcgc
tacgacaacctgaagcatctgtccaacaagaaggatccgcgcaagcatcgctacgagacc
aagggcctgtccattgtcaatctgctcttctccgccgccagcggggatgtcacggctctg
cgtcgccaccgtctgtccggcatggacatcaccctggccgactacgatggccgcaccgcc
ctgcacttggccgcctccgaagggcacttggaatgcgtgaagttcctgctggagcagtgc
catgtgccacacaatcccaaggatcgctggggcaatctgcccgtggacgaggccgaaaac
ttcaaccactccgatgtggtggagtacctgaagaagtgggctgagaacgccaaggatgcg
ccgcagcagtgcatgtccgacgccgtcaccaccaagaccgaagctgatgaggagctgccc
tgtaatccggacgatgtagttgccagcggcatatccagtcccattccaacagtatcggag
ccacgtagccccagccccgtttcctcggaggacggcagcacagtgagcggcaccagcgtg
gacaagaccaagcccggcctctag

DBGET integrated database retrieval system