KEGG   Drosophila mojavensis: Dmoj_GI20018Help
Entry
Dmoj_GI20018      CDS       T01062                                 

Definition
GI20018 gene product from transcript GI20018-RA
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
dmo  Drosophila mojavensis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dmo03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 236 aa AA seqDB search
MADDWESAADSEIVIRPNAANNINKWEGEDDDEDVKESWEDEEEKKDEEKPTKTEAPVKT
KPNKALKAKLEEQERLKEEEEQKRLAEMTPEEKLAEKLRLQKIQEESDLKSALETFGVTS
IGGGLDAFNPESKEEFKEFGATLSWKVAQYRESIHFPQFIEDLVRSLCCNLSAADIKKVK
MSVESLHSEKLKMEKAAAKKSAMKGKGKVSLRTENDDIDGYQKYGNDFTDDYDDFM
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgactgggaatccgccgccgacagtgaaattgtcatacgaccgaatgcagct
aacaacataaacaagtgggagggcgaggacgacgacgaagatgttaaggaaagctgggag
gatgaagaggaaaagaaagatgaggagaagccaacgaaaacagaagcgccagtcaaaact
aaacccaataaggcgctaaaagcgaaattggaggagcaggagcgccttaaagaagaagag
gaacagaagcgtttagctgagatgacacccgaagaaaaattagcggaaaagctgcgctta
caaaagattcaagaagaatcagatctaaagagtgctctagaaacattcggtgtcacaagt
ataggcggtggactcgatgccttcaatccggagagtaaagaagaattcaaggagttcggt
gccacgcttagctggaaggttgctcaataccgagaatccatacactttccacaattcata
gaagatctagtgcgcagcttatgctgtaacttgagcgctgctgatattaagaaggtcaaa
atgagtgtggagagcttgcactcggaaaagcttaaaatggaaaaagcagctgccaagaaa
tcggccatgaagggcaagggaaaagtttcgttgcgaacggaaaatgatgatatcgatggc
tatcaaaagtatggcaatgattttaccgatgattatgatgattttatgtga

DBGET integrated database retrieval system