KEGG   Drosophila mojavensis: Dmoj_GI20474Help
Entry
Dmoj_GI20474      CDS       T01062                                 

Definition
GI20474 gene product from transcript GI20474-RA
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dmoj_GI20474
Protein kinases [BR:dmo01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   Dmoj_GI20474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 306 aa AA seqDB search
MSEPQCEEDSVPLNYKELDIIGTGAYGTVYRARDNLTGKFVAIKKVRITLTENGVSASTL
REISLLKQLNTYDHANIVKLFEVCQFLERDGKLLILLIFEHLEQDLSDLIEALPPCGMSS
LNVQRLARELLTGVDFLHAHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTYGADMKLTSV
VVTLWYRAPEVLLAQGYNSTVDIWSAACIIFEMIKRKPLFPGNSEKDQLDRIFQLTGRPT
EQEWPKSISITREHFPDRARKRPSDFCPGLCEFADDLLNQMLAYDLHQRPSALECLNHAY
FKKEPL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagccacaatgtgaggaggatagtgtaccgttaaactataaggaattggatatt
attggcacaggcgcctatggcaccgtttatcgggcacgcgacaatctaacaggcaaattc
gtggccatcaagaaggtgcgcataacactcacggaaaacggagtgagtgcatcaacgctg
cgagagatttcactgctcaagcagctaaacacatacgatcatgcgaacattgtcaaactg
ttcgaagtatgccagttcttggaacgtgatggcaaattgttgattctgcttatttttgag
cacttggaacaggatctatccgacttgatcgaagcattgccaccatgcggcatgtcgtcc
ctaaacgtccagcgcttggctcgagagctattaaccggagtggactttctgcatgcccat
cgcattattcatcgcgatttgaaaccccaaaatctgctcgtctcatcgcagggccatttg
aaaatagccgactttggcttggccaagacgtatggcgcggacatgaaactcacctccgtg
gtggttaccctgtggtatagagcgcccgaggtgctgctcgcccagggctacaacagcacc
gtcgacatctggagcgcagcttgcatcatctttgagatgattaagcgtaagccgctcttc
ccgggcaactctgagaaggatcagctggatcgcatcttccagctgactggccgcccgacg
gagcaggagtggccaaagagcatctccattaccagggaacattttccagatcgcgctcgc
aagcgaccctcagacttctgcccgggcctatgcgaattcgctgatgatttgttgaatcaa
atgcttgcgtatgacctgcatcagcgtccctctgcgttggagtgcttgaaccacgcctac
ttcaagaaggagccactgtaa

DBGET integrated database retrieval system