KEGG   Drosophila mojavensis: Dmoj_GI20683Help
Entry
Dmoj_GI20683      CDS       T01062                                 

Definition
GI20683 gene product from transcript GI20683-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dmo  Drosophila mojavensis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dmoj_GI20683
  Lipid metabolism
   00062 Fatty acid elongation
    Dmoj_GI20683
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dmoj_GI20683
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dmoj_GI20683
Lipid biosynthesis proteins [BR:dmo01004]
 Fatty acid synthase
  Component type
   Dmoj_GI20683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 284 aa AA seqDB search
MRIIYLLIVCMYFVGSLAYKPVVILHGILSGAESMTVLVRHIEKFHPGTVVYNCDKFSGW
YSLENAWRQVQQIKDYIDQIGKLHPEGIIVLGYSQGGLLARAAIQSLPNHNVKTFISLSS
PQAGQYGTSFLHLIFPDLAAKTAFELFYSRVGQHTSVGGYWNDPHKQDLYMKYSEFLPLI
NNEKLSSNSTSFKMGMVRLNKLVLIGGPNDDVITPWQSSHFSYFNESLNVIPFYKREIYM
NDSIGLKTLLEANKLIIIVKPFVHHLSWHLNKRVINEVIMPYLD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagaataatatacttgctaatagtatgtatgtactttgttgggtctttggcgtacaag
cctgttgtgatactccatggcatattatcgggagctgaatctatgactgttttggtgcga
catattgagaaatttcatccgggtacagtcgtgtacaattgtgataagttcagcgggtgg
tacagcctggagaatgcctggcggcaagtccaacaaataaaagattacatagatcaaatt
ggaaaactgcacccggaaggcataattgtattaggctactctcaaggcgggctcttggcg
agggcggcgattcaaagcttacccaaccacaatgtaaaaacctttatatcgttatcatca
cctcaagctggacaatatggaacaagtttcttgcacttaattttccctgatcttgcggca
aaaactgcatttgagctattctactcgcgggtggggcaacacacatctgtaggcggctac
tggaatgacccacataaacaagacctatatatgaaatatagtgaattcttacccttgatt
aacaatgagaagctgagctccaattcaacttcgttcaaaatgggaatggtacggctgaat
aagcttgtcctaatcggaggaccaaacgatgatgttattacaccatggcaatctagtcat
tttagttacttcaatgaatcattgaatgtgattccgttttataaacgggaaatctacatg
aatgactcaatcggattgaagaccttactggaagctaataaactaattattattgttaag
ccattcgtacatcacctttcgtggcatttgaacaaacgagttatcaatgaagttataatg
ccatatttggattaa

DBGET integrated database retrieval system