KEGG   Drosophila mojavensis: Dmoj_GI20812Help
Entry
Dmoj_GI20812      CDS       T01062                                 

Definition
GI20812 gene product from transcript GI20812-RA
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dmo  Drosophila mojavensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dmoj_GI20812
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dmoj_GI20812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 274 aa AA seqDB search
MKPQANEQNGSTQNGDIAIDAATVAMDAAAIVPTAAAAAAAVGAGAVVPAKSSQQLKLEL
LNIGNGNGHENCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPER
AAKAMLYFTKGYDQNLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYL
PCNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRG
VQKINSKTVTSTMLGVFRDDPKTREEFLNLVNSK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcaagctaacgaacaaaatggtagcactcaaaatggcgacattgccatagat
gctgccaccgtcgccatggacgctgccgcgatcgtaccaacagcagcagcagccgcagct
gcagtcggcgcgggcgctgttgttcctgccaaaagcagtcaacagctgaaactggaattg
cttaacataggcaacggaaatggccatgagaactgcacttttcaccatgatctggagctg
gatcacaagccgccaacacgtgaggcattgctacctgatatggcgcgctcctaccgcctg
ctgttgggcggcctcggcgagaatcccgacagacagggcctgatcaagacaccggaacgt
gctgccaaggctatgctgtatttcaccaagggttacgatcagaatctggaggatgtgctt
aatggcgccgtctttgatgaggatcatgatgaaatggtcgttgtgaaggacattgaaatg
ttttccatgtgcgagcatcatttggtgcccttctatggaaaagtgtctatcggttatttg
ccatgcaataagattctgggtctcagcaagctggctcgcatcgtggaaatcttttcgcgt
cgtcttcaggtgcaggagcgcttgaccaagcaaattgcagttgctgtaacacaggcagtg
cagccagcaggtgttgctgttgttgttgagggcgtacacatgtgcatggtcatgcgtggc
gtgcagaaaatcaatagcaaaactgttacctcgactatgcttggcgtatttcgcgatgat
ccaaagacgcgcgaggagttcctaaatctagtcaatagcaaataa

DBGET integrated database retrieval system