KEGG   Drosophila mojavensis: Dmoj_GI20840Help
Entry
Dmoj_GI20840      CDS       T01062                                 

Definition
GI20840 gene product from transcript GI20840-RA
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
dmo  Drosophila mojavensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmoj_GI20840
Translation factors [BR:dmo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dmoj_GI20840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 690 aa AA seqDB search
MAKKKSEEHSGADANDSDYNEEPNFDDPPGYVDNISDEDLLGDMLAQRPSEADGVESVVV
VDNMPKVEPSRLEKLKSVINKLFSQCGEIVNVVYPVDEEGKTKGYAFMEFKTASQAEDAV
KKLNNHRLDKNYTFAVNLFTDFQKYENIPEKWEPPTVQPFKVQSDLYNFINDPDAYDQYC
VAAETAPNCVQVGFWQNTLPEPNELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSS
FQKIQKFPHPGTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGAEKRSFVGDGMSVLSM
FRWSHDDKFVARMGENSIHIYETPSFYLLDLKSIKIAGIRGFSWSPTDNVIAYWVEEQNQ
IPARVTLMEIPKKREIRNKNLFHVADCKLHWQKSGDYLCVKVDRYSKLKKDKKELDVKFL
GMFYNFEIFHMREKEIPVDSVEIRELILAFAWEPIGNKFSIIHGEPNSANVSFYEVNKGV
KPSLVKRLEKKSCTHLFWSPRGQFIVMANLTMGTFEFVDTTNDYIISASPDHFRASEVEW
DPTGRYVVTGVSSWKVKEDTGFNMYTFQGRIIRRTILKNFVQFLWRPRPPTLLSEEKQKE
IKKNLKKYYPIFEQKDRLRLTRASKELLEKRAQLRETFMEYRNKRIAEWKDQKSRRIMLR
GHVDTDNLETDEVDEEVVEFLVKEEVTLLE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaagaaaagtgaggagcattcgggtgcggacgcaaacgacagcgactacaat
gaggagcccaatttcgatgatccgcccggttacgtggacaacattagcgatgaagattta
ttgggagatatgctggcccaacgcccatccgaagccgatggtgttgaaagtgtcgttgta
gtggataatatgccgaaagtagagccaagccgcctggaaaaacttaaatcggttatcaac
aagctgttctcgcagtgcggtgaaatcgttaacgttgtctatccggtggatgaggagggc
aagacaaaaggctatgcattcatggaattcaagaccgccagtcaggctgaggatgcagtc
aagaaattaaacaaccatcgcctggacaagaattatacttttgccgtaaatttgtttaca
gacttccagaagtatgaaaatataccggagaagtgggagccgccgactgtacaacccttt
aaggtacagagtgatctgtataattttataaacgatcccgatgcctatgatcagtactgc
gtagcggctgagacagcaccgaattgcgtgcaggttggcttctggcagaacactctgccc
gaacccaatgagctggagacacgtgaacgttttacggacacgtttgtgaagtggtcgcct
ctgggcacctatgtggtcaccttccacaaacccggagtcgccatttggggtggcagcagc
ttccagaaaattcaaaagtttccccatccaggcacccagttcgtcgaattctcgccatgt
gagaattatttggtaacctatggcccaacaccaacgggtcaaaagatcatcatttgggat
atacgcactggggctgagaagcgttcgtttgtgggcgatggcatgtctgtgttatcaatg
ttccgctggtcgcacgatgacaaatttgtggcacgcatgggcgagaattcgattcacatc
tacgagacgccatcattttacttgcttgacttgaagtccatcaagatagcgggcatacgc
ggcttctcgtggtcgcctacggacaatgtcatcgcttactgggtggaagagcagaatcaa
atacccgcacgtgtcaccctgatggagatccccaagaagcgggagattcgcaacaagaat
cttttccatgtggccgactgtaagcttcattggcaaaagtctggcgattatctgtgtgtt
aaggtcgatcgctactccaagctgaagaaggataagaaggagctggacgtcaagtttctg
ggcatgttctacaattttgagatattccacatgcgcgaaaaggaaatacccgtggattcg
gtggaaatacgtgagctgattcttgcttttgcctgggagcctattggaaataaattttcc
attatacatggcgagcccaactccgccaatgttagcttctacgaggtgaataagggtgtc
aagcccagccttgtgaagcggctggagaagaagtcctgcactcatctgttctggtcgcca
cgtggccaattcatcgtcatggccaatctgaccatgggcacctttgagttcgttgatacc
acgaatgactacatcatcagtgcatcgccggatcacttccgtgcatcggaggtggaatgg
gatccaactggtcgttatgtcgtcactggcgtctcatcgtggaaggtgaaagaggatacc
ggctttaatatgtataccttccagggtcgcatcatcaggcgcaccattttgaagaacttt
gtgcagttcctttggcgcccgcgaccaccgacgctacttagcgaagagaagcaaaaggag
atcaagaaaaatttgaagaaatattatcctatatttgaacagaaggatcgtctgcgcttg
acccgtgcctccaaggagttgctcgaaaagcgcgcacagctgcgagagaccttcatggag
taccgcaacaagcgcatcgcggaatggaaggatcaaaagagccgtcgcatcatgctccga
gggcatgtggatacggataatttggagaccgatgaagttgatgaggaagttgttgaattt
ttagtcaaggaagaagtaaccctgctagagtaa

DBGET integrated database retrieval system