KEGG   Drosophila mojavensis: Dmoj_GI20956Help
Entry
Dmoj_GI20956      CDS       T01062                                 

Definition
GI20956 gene product from transcript GI20956-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dmo  Drosophila mojavensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dmo00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 596 aa AA seqDB search
MNEGRYGRFGALIGVAYVSSTHCRFLIYSTKNAEVLAYHELKLRQIVHNAGWLEYDPAEI
WKHMQECIETAYKNLVILEISPHDIIAVGIANQRGTTVLWNKRTGQALHNAIGWSDCRST
ALLKSLLHNVKRNVNYLRYRSGLPLSSCFSALKIKWLLENVPSVGKAIEEDQCLFGTLDS
WLIWNLTGGVDVGVHSTDVTNAHYTSLMNVATQQWDIKLCKFFKLPMGILPRIRSNSEIF
GYIVQGALMGVPIAGVMGEHPAALLGQLCVKAGQNVCTLDDSCFVLLNTAQQRVESENGL
ITGIAHKLGPTADTHFTLEGAISNAGSTVNWLRQGLRINTEINSNDNVVESLNTFLGESS
MISSSCSSSMLNAECGLAAKRSEITFVPAFHGLYAPYWRYDARGIILGLTSQTTAENITQ
AAYEATGFQIYEVLQAFKRDTPNWDPSCMQSVLTFGGEYAEDSHLVQFVADIIGWMLERP
QTTSPAGLGAMIAAGIAMRVVSLPYATRMYAPPTDVFSPTTTQNRRELLYRRWDYAVKKC
LNWNNYETYEADVELFAQRERDPNLPIRRSIPGSIFLTTSFALLLLASFLKNNRLA
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagggccgctatggtagatttggagcactcattggcgttgcgtacgtgagcagc
acccattgtagatttttgatttactcgacaaaaaatgcagaagttctggcctatcacgag
ctcaaactgcgccagatagtgcataatgccggctggctggaatacgatcccgcagaaata
tggaagcacatgcaggagtgcattgagactgcctataaaaacctggtgatactcgaaatc
agcccgcatgacatcattgcagtgggcattgccaatcaacgcggcaccacagtgctctgg
aacaagcgaacgggtcaggccttgcacaatgccattggttggtccgactgccgtagcaca
gcgttgcttaagtcactccttcataatgtgaagcgtaatgtgaactatttgcgctatcgc
agtggtctcccacttagtagctgttttagtgctctgaagatcaagtggctgctggagaat
gtgccgtcggtgggcaaggccattgaggaggatcagtgcttgtttggcacgctggattcc
tggctgatatggaatctaactggtggcgtcgatgtgggcgttcattcgacagacgtgacc
aatgcacattacacatcgctgatgaatgtcgccacacagcaatgggacataaagttgtgt
aaattcttcaaactgccaatgggcatattgccgcgcattcgctcaaattcagagatcttc
ggttacattgttcagggggctctgatgggcgtccccattgcgggcgtaatgggcgagcat
ccagctgctctgctgggacagctgtgcgtcaaggcgggccaaaatgtttgtacactggat
gacagctgctttgtgctgctgaacacggcccagcagagagtggagtcggagaatgggttg
ataacgggcatagcgcacaaattgggacccacagcagatacgcatttcacacttgaggga
gccatttccaatgcaggatccactgtcaattggctgcgtcagggactgcgcatcaatacc
gaaattaattccaatgacaatgttgtagagtcattgaacacatttttgggcgagagctca
atgatctcttcctcttgctcctcaagcatgctcaatgcggagtgcggactggcggccaag
cgttcagagatcacgtttgtgcccgccttccatggcttatacgcgccctactggcgctat
gatgcgcgcggaattatacttggtctgaccagccaaacgacggccgagaacattacacag
gctgcctacgaagcgactggcttccagatctacgaagtgctgcaggccttcaagcgagat
acgcccaactgggatccgtcatgcatgcagtcggtcttgacatttggcggcgagtatgcg
gaggacagtcatctggtgcagtttgtggcggacattattggctggatgctcgaacggccg
cagacaacatcgcccgctggtctgggcgctatgatagctgctggcatagctatgcgtgtg
gtctctctaccatatgcgacgcgtatgtatgcgccacccacagacgtcttctcacccaca
actacacagaatcgtcgtgaactgctttatcgtcgctgggactatgcggtcaagaagtgt
ttgaattggaataattatgagacttatgaggcggatgtggagctgtttgctcagcgtgaa
cgggatcccaatttgcccatacgacgctccataccgggcagtatctttctgaccacatcc
tttgcgttgctgttgttggccagttttttaaagaacaatcgcttagcttag

DBGET integrated database retrieval system