KEGG   Drosophila mojavensis: Dmoj_GI21110Help
Entry
Dmoj_GI21110      CDS       T01062                                 

Definition
GI21110 gene product from transcript GI21110-RA
Orthology
K14298  
mRNA export factor
Organism
dmo  Drosophila mojavensis
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmoj_GI21110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 349 aa AA seqDB search
MFGAAQTTTNRMNDFEVASPPDDSVTALEFSPSTLQVPKNFLIAGSWDNSVRCWEVEQNG
ATVPKSMKTMGGPVLDVCWSDDGTKVFMASCDKQVKLWDLASDQVMQVAAHDGPVKTCHM
VKGPNYTCLMTGSWDKTLKFWDTRTPNPMMAINLPERCYCADVDYPMAVVGTAGRGLIIY
SLENSPTEYKRQESPLKYQHRTISIFKDKKKAPTGYALGSIEGRVAIQYVNPVNPKDNFT
FKCHRSTGTSGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSEAMDQSI
TKCGFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRAN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtttggggccgcacagacgacaacgaatcgtatgaacgacttcgaggtagcatcgcca
ccagacgattctgtaacagcactcgagttcagtccaagcacattgcaagtgccaaagaat
tttctcattgccggcagctgggacaacagcgtgcgctgttgggaggtggaacaaaatgga
gcaaccgtgccaaagtctatgaaaacgatgggagggccagtgctggatgtatgctggtca
gacgacggcaccaaagtgttcatggcgtcatgtgacaagcaagtaaagctctgggatctc
gcctccgatcaggtaatgcaagtagctgcccacgacggaccggtcaaaacctgccacatg
gtcaagggtcccaattacacatgtcttatgacaggcagctgggacaaaacgctcaagttc
tgggacacgcgcacacccaatcccatgatggccataaatctgcctgaacgatgctattgc
gctgatgtagactaccccatggctgtggtgggcactgcgggtcgtggtctaatcatctac
tcgttggagaacagtcccaccgagtacaagcgacaggagagtccgctcaagtatcaacat
cgtaccatatccatattcaaggacaaaaagaaggcgcccacgggctatgcattaggcagc
atcgaaggtcgtgttgctatacagtatgtgaacccagtgaatccaaaagataactttaca
ttcaagtgccatcgctcgacgggcacctccggattccaggacatttatgcggttaatgat
attgcattccatccggtgcatggaactctggttactgttggatcggacggcacatttagc
ttctgggacaaagatgcacgcaccaagctcaaatctagcgaggcgatggatcaatccata
acaaaatgtggcttcaatgccaatggccaaatattcgcatatgctgtcggctatgactgg
tccaagggacacgagtacttcaaccccgccaagaagccacagatattcctacgctcctgc
tacgacgagctgaaaccgcgcgctaattga

DBGET integrated database retrieval system