KEGG   Drosophila mojavensis: Dmoj_GI21247Help
Entry
Dmoj_GI21247      CDS       T01062                                 

Definition
GI21247 gene product from transcript GI21247-RA
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
dmo  Drosophila mojavensis
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dmoj_GI21247
Enzymes [BR:dmo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dmoj_GI21247
Peptidases [BR:dmo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dmoj_GI21247
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmoj_GI21247
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 271 aa AA seqDB search
MAHVVPLLLGLCLALVSLAGALPLQDSDSGSPNGRIVGGYETNIAVYPHQISLRRKGITT
PKNAFTHTCGGSILTKDTVITAAHCIIATVASQYKVVAGTSRRNGSDGIIVSVDEIVMHE
NYDPDNYDNDIALLRLSSPLPLNNFTMRAIELPTEPASDGAISTVSGWGTIASGGSPSDQ
LRAVDVPIVSNEVCDEDYGGGRITAGMLCAGVRGQGGKDACQGDSGGPLIVKNKLQGIVS
WGRSCALPTHPGVYTNVFHYLDWIKSKVQLA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgtggtacctttgctgctcggcctttgcctggcccttgtctccttggctgga
gcacttcccttgcaggactccgactcgggatcacccaacggccgcattgtgggcggctat
gagacgaacattgcggtctatccgcatcagatctcactgcgacgcaaaggaatcacaact
cccaaaaatgcctttacgcacacctgcgggggctccatcctcaccaaggacaccgtcatc
acggccgcacactgtattatcgccacggtagcctctcagtacaaagtcgtggcaggcacc
agccgcaggaatggcagcgacggcatcatcgtctccgtcgacgaaattgtcatgcacgag
aactacgatcccgacaactacgacaacgacattgctctgctcaggctgagctcgccgctg
cccttgaacaactttaccatgagagcaatcgagctgccaacagagccagcgagcgatgga
gccattagcactgtcagcggctggggcaccatcgcgtccggcggctcgccatcggatcag
ctgcgcgctgtcgatgttcccatcgttagcaatgaggtctgtgacgaggattacggaggc
ggacgcatcacggcgggcatgctgtgcgcaggtgtgcgcggccagggcggcaaggatgcc
tgccagggtgactctggtggtccgctgatcgttaagaataagttgcaaggcatcgtctcc
tggggcagatcgtgcgctctgcccacgcatccaggcgtttacaccaatgtcttccactat
ctcgactggattaagtccaaggtgcagttggcctga

DBGET integrated database retrieval system