KEGG   Drosophila mojavensis: Dmoj_GI21261Help
Entry
Dmoj_GI21261      CDS       T01062                                 

Definition
GI21261 gene product from transcript GI21261-RA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dmo  Drosophila mojavensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dmo00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 690 aa AA seqDB search
MGDPMKVEVKDIDKLLEMDGYLKPFEREIRRRHGVLKDWIAKIDQCEGGLEEFSQGYKYY
GLHFQPDNSVIAREWAPGARDVYLTGDFNNWHWESHPYKKLPFGKWELHLPANPDGSAPI
KHLSEIKVIIRNQHGQLLDRLSPWAKYVVQPPKSANQGVNYKQYVWQPPEGERYQRQNAR
PPKPKSLRIYECHVGIASQEPRVGSYDEFADRIVPRIKRQGYNCIQVMAIMEHAYYASFG
YQVTSFYAASSRYGNPEQLKRMIDVAHAQGLYVLLDVVHSHASKNVQDGLNQFDGTNSCF
FHDGARGEHALWDSRLFNYTEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIG
EGFSGDYNEYFGLNVDTDALNYLGLANYMLHKLDPEVITIAEDVSGMPTLCRPVSEGGIG
FDYRLGMAIPDKWIELLKEQTDDQWDIGNIVHTLTNRRWMENTVAYAESHDQALVGDKTI
AFWLMDKEMYTHMSTLSEPSIIIDRGLALHKMIRLITHALGGEAYLNFMGNEFGHPEWLD
FPRVGNNDSYHYARRQWNLVDDNMLKYKYLNEFDRAMNELEERYGWLHSGPAYVSWKHQS
DKTIHFERAGLVFVFNFHPTQSFSDYRVGTNWAGTYQAVLSSDDPLFGGHNRIDMNCKHQ
SDPWGHAGRSNFIQVYTPCRTAVVYARISD
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatccaatgaaagtggaagttaaggacattgacaagctgctcgaaatggatggc
tatctgaagccgttcgagcgtgagattcgtcgccggcatggcgtactgaaggattggatt
gcgaagattgatcaatgcgagggcggcttggaagagttctcgcagggctacaagtactac
ggcctacactttcagccggataattcagtgattgcacgcgagtgggcgccgggtgcaaga
gatgtgtatcttactggcgatttcaacaattggcactgggaatcgcatccgtacaagaag
ctgccctttggcaagtgggagcttcatttgcccgccaatccagatggcagtgcgccaatt
aagcatcttagcgagataaaagtcatcatacgcaaccagcacggtcagctattggatcgc
ctctcgccctgggccaagtatgtggtgcagccgcccaagagcgccaatcagggagtcaac
tacaagcagtatgtgtggcagccgccagaaggagagcgctatcaacgacagaacgcacga
ccgcccaagcccaagtccctgagaatctacgagtgccatgtgggcatagcctcgcaggag
cctcgagtgggcagctacgatgagttcgcggatcgcattgtgccgcgcattaagcgacaa
ggctacaactgcatccaggtgatggccatcatggagcacgcctactacgccagctttggc
taccaggtgaccagtttctatgcggcttccagccgctacggcaacccggagcaactcaag
cgcatgatcgatgtggcccacgcccagggtctctacgtgctacttgatgtggtgcactcg
catgcgtccaagaacgtgcaggatggcctaaatcaattcgatggcaccaacagctgcttc
ttccacgacggcgcacgtggtgagcacgccctttgggatagccgtctgttcaactatacg
gagtacgaagtgctgcgcttcttgctgtccaacttgcgctggtggcacgatgagtacaat
ttcgacggctatcgcttcgatggcgtcacctccatgttataccactcgcgcggcatcggc
gaaggcttcagtggcgactacaacgaatactttggcctcaacgtggacacagatgcactc
aactatctgggtctcgccaactacatgctgcacaagctggaccctgaggtcataaccata
gctgaggacgtttctggcatgccgacactgtgtcgccccgtgtcggagggcggtattgga
tttgactatcgcctgggcatggccattccagacaagtggatcgagctgctgaaggaacaa
accgacgatcagtgggacattggcaacattgtgcacacgctgaccaaccgacgctggatg
gagaacacggtggcctatgccgagtcccacgaccaggcgcttgtcggcgacaagaccatt
gccttctggctgatggacaaggaaatgtacacgcatatgtccacattgtcagagccgtcg
ataatcattgatcgtggactggcactgcataagatgattcgtctcatcacgcatgcattg
ggcggcgaggcatatctcaatttcatgggcaatgagttcgggcatcccgagtggctcgac
tttccgcgcgtgggcaacaatgactcgtaccattatgcgcgtcgccaatggaatttggtg
gatgacaatatgctaaagtacaagtacctaaacgaatttgaccgtgccatgaatgagttg
gaggaacgctatggctggctgcactcgggccccgcctatgtgagctggaaacaccagagc
gacaagacaatccactttgagcgcgcgggtctcgtttttgtgttcaacttccatcccact
cagagcttcagtgattatcgcgtgggcaccaactgggctggcacctatcaagctgtgctt
tcctccgacgatcccctctttggcggccacaatcgcatcgacatgaattgcaagcatcaa
tcggatccctggggccatgccggtcgctccaacttcattcaagtctacacgccttgtcgc
accgccgtcgtttatgccagaatcagcgattag

DBGET integrated database retrieval system