KEGG   Drosophila mojavensis: Dmoj_GI21331Help
Entry
Dmoj_GI21331      CDS       T01062                                 

Definition
(RefSeq) GI21331 gene product from transcript GI21331-RA
  KO
K02358  
elongation factor Tu
Organism
dmo  Drosophila mojavensis
Brite
Translation factors [BR:dmo03012]
 Eukaryotic Type
  Elongation factors
   Dmoj_GI21331
 Prokaryotic Type
   Dmoj_GI21331
Mitochondrial biogenesis [BR:dmo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dmoj_GI21331
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmoj_GI21331
  Exosomal proteins of breast cancer cells
   Dmoj_GI21331
  Exosomal proteins of colorectal cancer cells
   Dmoj_GI21331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 488 aa AA seqDB search
MMSQAFASPISRIGVALRWNRRSLSTARFVRNVTRSRMVTSSTFIKNCPTANCIPATIGN
LQQYVRQYANEKKVFERTKPHCNVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEID
NAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDG
AMPQTREHMLLAKQIGIDHIVVFINKVDAADQEMVDLVEMEIRELLTEMGYDGDKIPVIK
GSALCALEDKNPEIGANAILKLLEEVDNFIPTPVRELDKPFLLPVENVYSIPGRGTVVTG
RLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKRG
MVMCKPGSVKALDQLEAQVYILSKEEGGRTKPFMSFIQLQMFSRTWDCAVQVQIPDKEMV
MPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGVVTNVLPALTESQRSELTEGKKAR
EKKVAAKK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcccaggcatttgcatctcctattagccgaatcggtgttgcactacgttggaac
cggcgtagtttgagcacggcgcgatttgtacgtaatgtaacacgttcacgtatggtaacc
agtagtacctttataaaaaattgcccaactgcaaattgtatccctgccactattgggaat
ttgcagcaatatgtgcggcagtatgctaatgaaaaaaaagtgtttgaacgcactaaacct
cattgtaatgttggcaccattggtcatgtggatcacggcaagactaccctaacggcggct
ataacgaaagtattagctgataagcagctggcagagagcaaaaaatacaatgagattgac
aacgcgcctgaggagaaagctcgtggcataactattaatgtggcgcacgttgagtatcag
acagagacccgtcactacggtcatactgattgtcccggacatgctgactacattaagaat
atgataacaggcaccgcacaaatggacggcgctatattagtagtagccgccacagatggt
gcgatgccgcaaacacgtgagcatatgttgttagcaaaacaaataggcatcgaccatatt
gtggtgtttatcaacaaagtcgatgcagccgatcaagaaatggtggatcttgtcgaaatg
gaaatacgtgaacttcttaccgaaatgggttacgatggcgataaaattccggtaatcaag
ggctcagcattgtgtgctcttgaggacaaaaatcctgaaattggcgctaatgcgatactt
aaattgcttgaagaggtagataatttcattcctacgccagtgcgagagttagataaacca
ttcttgttgcccgtggaaaatgtatattccattcctgggcgtggtacagtcgttacgggt
cgtctagaacgcggagtcgttaagaagggaatggaatgcgagttcgtgggctacaacaag
gttctaaaatccacagtcaccggagtagaaatgttccatcagattcttgaggaggctcaa
gctggtgatcagttgggcgccttagtgcgaggtgtaaagcgtgatgatattaaacgtgga
atggtcatgtgcaaaccaggaagtgtcaaagctctagatcagttggaggcgcaagtgtat
atactgtccaaggaggaaggtggtaggaccaaaccgtttatgtcattcattcagctgcag
atgttttctcgtacatgggattgtgctgtgcaagtacaaataccggacaaggagatggtt
atgcctggcgaggatacgaaacttatattgcgcctgatacgtccaatggtcttagagcaa
ggtcaacgctttacacttcgtgatggcaatttaaccttaggcacgggcgttgtcacaaat
gttttgccggcccttacagaaagtcagcgttctgagctaacggagggtaaaaaggcgcgt
gagaaaaaggtcgctgccaaaaaataa

DBGET integrated database retrieval system