KEGG   Drosophila mojavensis: Dmoj_GI21331Help
Entry
Dmoj_GI21331      CDS       T01062                                 

Definition
GI21331 gene product from transcript GI21331-RA
Orthology
K02358  
elongation factor Tu
Organism
dmo  Drosophila mojavensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 451 aa AA seqDB search
MVTSSTFIKNCPTANCIPATIGNLQQYVRQYANEKKVFERTKPHCNVGTIGHVDHGKTTL
TAAITKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADY
IKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDHIVVFINKVDAADQEMVDL
VEMEIRELLTEMGYDGDKIPVIKGSALCALEDKNPEIGANAILKLLEEVDNFIPTPVREL
DKPFLLPVENVYSIPGRGTVVTGRLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILE
EAQAGDQLGALVRGVKRDDIKRGMVMCKPGSVKALDQLEAQVYILSKEEGGRTKPFMSFI
QLQMFSRTWDCAVQVQIPDKEMVMPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGV
VTNVLPALTESQRSELTEGKKAREKKVAAKK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccagtagtacctttataaaaaattgcccaactgcaaattgtatccctgccact
attgggaatttgcagcaatatgtgcggcagtatgctaatgaaaaaaaagtgtttgaacgc
actaaacctcattgtaatgttggcaccattggtcatgtggatcacggcaagactacccta
acggcggctataacgaaagtattagctgataagcagctggcagagagcaaaaaatacaat
gagattgacaacgcgcctgaggagaaagctcgtggcataactattaatgtggcgcacgtt
gagtatcagacagagacccgtcactacggtcatactgattgtcccggacatgctgactac
attaagaatatgataacaggcaccgcacaaatggacggcgctatattagtagtagccgcc
acagatggtgcgatgccgcaaacacgtgagcatatgttgttagcaaaacaaataggcatc
gaccatattgtggtgtttatcaacaaagtcgatgcagccgatcaagaaatggtggatctt
gtcgaaatggaaatacgtgaacttcttaccgaaatgggttacgatggcgataaaattccg
gtaatcaagggctcagcattgtgtgctcttgaggacaaaaatcctgaaattggcgctaat
gcgatacttaaattgcttgaagaggtagataatttcattcctacgccagtgcgagagtta
gataaaccattcttgttgcccgtggaaaatgtatattccattcctgggcgtggtacagtc
gttacgggtcgtctagaacgcggagtcgttaagaagggaatggaatgcgagttcgtgggc
tacaacaaggttctaaaatccacagtcaccggagtagaaatgttccatcagattcttgag
gaggctcaagctggtgatcagttgggcgccttagtgcgaggtgtaaagcgtgatgatatt
aaacgtggaatggtcatgtgcaaaccaggaagtgtcaaagctctagatcagttggaggcg
caagtgtatatactgtccaaggaggaaggtggtaggaccaaaccgtttatgtcattcatt
cagctgcagatgttttctcgtacatgggattgtgctgtgcaagtacaaataccggacaag
gagatggttatgcctggcgaggatacgaaacttatattgcgcctgatacgtccaatggtc
ttagagcaaggtcaacgctttacacttcgtgatggcaatttaaccttaggcacgggcgtt
gtcacaaatgttttgccggcccttacagaaagtcagcgttctgagctaacggagggtaaa
aaggcgcgtgagaaaaaggtcgctgccaaaaaataa

DBGET integrated database retrieval system