KEGG   Drosophila mojavensis: Dmoj_GI21331Help
Entry
Dmoj_GI21331      CDS       T01062                                 

Definition
GI21331 gene product from transcript GI21331-RA
Orthology
K02358  
elongation factor Tu
Organism
dmo  Drosophila mojavensis
Brite
Mitochondrial biogenesis [BR:dmo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dmoj_GI21331
Exosome [BR:dmo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmoj_GI21331
  Exosomal proteins of breast cancer cells
   Dmoj_GI21331
  Exosomal proteins of colorectal cancer cells
   Dmoj_GI21331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 451 aa AA seqDB search
MVTSSTFIKNCPTANCIPATIGNLQQYVRQYANEKKVFERTKPHCNVGTIGHVDHGKTTL
TAAITKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADY
IKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDHIVVFINKVDAADQEMVDL
VEMEIRELLTEMGYDGDKIPVIKGSALCALEDKNPEIGANAILKLLEEVDNFIPTPVREL
DKPFLLPVENVYSIPGRGTVVTGRLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILE
EAQAGDQLGALVRGVKRDDIKRGMVMCKPGSVKALDQLEAQVYILSKEEGGRTKPFMSFI
QLQMFSRTWDCAVQVQIPDKEMVMPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGV
VTNVLPALTESQRSELTEGKKAREKKVAAKK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccagtagtacctttataaaaaattgcccaactgcaaattgtatccctgccact
attgggaatttgcagcaatatgtgcggcagtatgctaatgaaaaaaaagtgtttgaacgc
actaaacctcattgtaatgttggcaccattggtcatgtggatcacggcaagactacccta
acggcggctataacgaaagtattagctgataagcagctggcagagagcaaaaaatacaat
gagattgacaacgcgcctgaggagaaagctcgtggcataactattaatgtggcgcacgtt
gagtatcagacagagacccgtcactacggtcatactgattgtcccggacatgctgactac
attaagaatatgataacaggcaccgcacaaatggacggcgctatattagtagtagccgcc
acagatggtgcgatgccgcaaacacgtgagcatatgttgttagcaaaacaaataggcatc
gaccatattgtggtgtttatcaacaaagtcgatgcagccgatcaagaaatggtggatctt
gtcgaaatggaaatacgtgaacttcttaccgaaatgggttacgatggcgataaaattccg
gtaatcaagggctcagcattgtgtgctcttgaggacaaaaatcctgaaattggcgctaat
gcgatacttaaattgcttgaagaggtagataatttcattcctacgccagtgcgagagtta
gataaaccattcttgttgcccgtggaaaatgtatattccattcctgggcgtggtacagtc
gttacgggtcgtctagaacgcggagtcgttaagaagggaatggaatgcgagttcgtgggc
tacaacaaggttctaaaatccacagtcaccggagtagaaatgttccatcagattcttgag
gaggctcaagctggtgatcagttgggcgccttagtgcgaggtgtaaagcgtgatgatatt
aaacgtggaatggtcatgtgcaaaccaggaagtgtcaaagctctagatcagttggaggcg
caagtgtatatactgtccaaggaggaaggtggtaggaccaaaccgtttatgtcattcatt
cagctgcagatgttttctcgtacatgggattgtgctgtgcaagtacaaataccggacaag
gagatggttatgcctggcgaggatacgaaacttatattgcgcctgatacgtccaatggtc
ttagagcaaggtcaacgctttacacttcgtgatggcaatttaaccttaggcacgggcgtt
gtcacaaatgttttgccggcccttacagaaagtcagcgttctgagctaacggagggtaaa
aaggcgcgtgagaaaaaggtcgctgccaaaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system